DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk2 and cdk-4

DIOPT Version :9

Sequence 1:NP_001163666.1 Gene:Cdk2 / 42453 FlyBaseID:FBgn0004107 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_510256.1 Gene:cdk-4 / 181472 WormBaseID:WBGene00000406 Length:342 Species:Caenorhabditis elegans


Alignment Length:321 Identity:115/321 - (35%)
Similarity:182/321 - (56%) Gaps:28/321 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LDNFQRAEKIGEGTYGIVYKARSNSTGQDVALKKIRLEGETEGVPSTAIREISLLKNL---KHPN 66
            :.:||..:.:|:|.||.||:.||...|:|.|||:|.:..:.||:|.:.:|||:::|:|   .|||
 Worm    35 MKDFQIHQALGKGAYGNVYRVRSLHDGKDYALKQIMISSKNEGIPQSVLREITVMKHLARKAHPN 99

  Fly    67 VVQL------FDVVISGNNLYMIFEYLNMDLKKLMDKKKDVFTPQLIKSYMHQILDAVGFCHTNR 125
            ::.|      .|.|.:...:.||.|..:.||...:.........|..|....||:.|:.|.||:.
 Worm   100 IISLKSVFHQLDPVRAILKINMIMERCDWDLHTFLRNIPRGVPEQQAKHVTAQIVRALDFLHTHS 164

  Fly   126 ILHRDLKPQNLLVDTAGKIKLADFGLARAFNVPMRAYTHEVVTLWYRAPEILLGTKFYSTGVDIW 190
            |:||||||||:|::....:|||||||::.:: ...|:|..|||||||:||:|| ..:|::.||:|
 Worm   165 IIHRDLKPQNILLNRDQTVKLADFGLSKEYS-NTTAFTTLVVTLWYRSPEVLL-QSYYNSTVDMW 227

  Fly   191 SLGCIFSEMIMRRSLFPGDSEIDQLYRIFRTLSTPDETNWPGVTQLPDFKTKFPRWEGTNMP--Q 253
            :||||.||:..|:.||.|.:|.:||..||:.:.||...:||..:.:.  :..||::..||:.  .
 Worm   228 ALGCIVSEIYCRQPLFVGQNEAEQLTDIFKKMGTPVGKDWPSESVIA--RDSFPQYRPTNLKDLS 290

  Fly   254 PITEHEAHELIMSMLCYDPNLRISAKDALQHAYFRNVQHVDHVALPVDPNAGSASRLTRLV 314
            |....:|.|.:...|.||.:.|:||:.||.|.:.:             |...:.||:.:.:
 Worm   291 PQMSKQAIEFVQQCLRYDHSKRLSARGALSHPFLK-------------PAVATKSRVLKQI 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk2NP_001163666.1 PLN00009 5..293 CDD:177649 112/298 (38%)
STKc_CDK1_CdkB_like 8..287 CDD:270829 112/289 (39%)
cdk-4NP_510256.1 PKc_like 38..324 CDD:304357 112/289 (39%)
S_TKc 38..324 CDD:214567 112/289 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24056
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.