DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk2 and Cdk6

DIOPT Version :9

Sequence 1:NP_001163666.1 Gene:Cdk2 / 42453 FlyBaseID:FBgn0004107 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_034003.1 Gene:Cdk6 / 12571 MGIID:1277162 Length:326 Species:Mus musculus


Alignment Length:311 Identity:133/311 - (42%)
Similarity:197/311 - (63%) Gaps:35/311 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DNFQRAE-------KIGEGTYGIVYKARS-NSTGQDVALKKIRLEGETEGVPSTAIREISLLKNL 62
            |:..||:       :||||.||.|:|||. .:.|:.||||::|::...||:|.:.|||:::|::|
Mouse     4 DSLSRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTSEEGMPLSTIREVAVLRHL 68

  Fly    63 ---KHPNVVQLFDV-VISGNN----LYMIFEYLNMDLKKLMDKKKDVFTP-QLIKSYMHQILDAV 118
               :|||||:|||| .:|..:    |.::||:::.||...:||..:...| :.||..|.|:|..:
Mouse    69 ETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGL 133

  Fly   119 GFCHTNRILHRDLKPQNLLVDTAGKIKLADFGLARAFNVPMRAYTHEVVTLWYRAPEILLGTKFY 183
            .|.|::|::||||||||:||.::|:||||||||||.::..| |.|..||||||||||:||.:. |
Mouse   134 DFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQM-ALTSVVVTLWYRAPEVLLQSS-Y 196

  Fly   184 STGVDIWSLGCIFSEMIMRRSLFPGDSEIDQLYRIFRTLSTPDETNWPGVTQLP--DFKTKFPRW 246
            :|.||:||:||||:||..|:.||.|.|::|||.:|...:..|.|.:||....||  .|.:|    
Mouse   197 ATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDIIGLPGEEDWPRDVALPRQAFHSK---- 257

  Fly   247 EGTNMPQPI------TEHEAHELIMSMLCYDPNLRISAKDALQHAYFRNVQ 291
                ..|||      .:....:|::..|.::|..||||..||.|.||::::
Mouse   258 ----SAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYGALNHPYFQDLE 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk2NP_001163666.1 PLN00009 5..293 CDD:177649 133/311 (43%)
STKc_CDK1_CdkB_like 8..287 CDD:270829 130/303 (43%)
Cdk6NP_034003.1 STKc_CDK6 11..300 CDD:270846 128/298 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.