DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk2 and Cdk5

DIOPT Version :9

Sequence 1:NP_001163666.1 Gene:Cdk2 / 42453 FlyBaseID:FBgn0004107 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_031694.1 Gene:Cdk5 / 12568 MGIID:101765 Length:292 Species:Mus musculus


Alignment Length:287 Identity:145/287 - (50%)
Similarity:201/287 - (70%) Gaps:5/287 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LDNFQRAEKIGEGTYGIVYKARSNSTGQDVALKKIRLEGETEGVPSTAIREISLLKNLKHPNVVQ 69
            :..:::.|||||||||.|:||::..|.:.||||::||:.:.|||||:|:|||.|||.|||.|:|:
Mouse     1 MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVR 65

  Fly    70 LFDVVISGNNLYMIFEYLNMDLKKLMDKKKDVFTPQLIKSYMHQILDAVGFCHTNRILHRDLKPQ 134
            |.||:.|...|.::||:.:.||||..|.......|:::||::.|:|..:||||:..:||||||||
Mouse    66 LHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQ 130

  Fly   135 NLLVDTAGKIKLADFGLARAFNVPMRAYTHEVVTLWYRAPEILLGTKFYSTGVDIWSLGCIFSEM 199
            |||::..|::|||||||||||.:|:|.|:.||||||||.|::|.|.|.|||.:|:||.||||:|:
Mouse   131 NLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAEL 195

  Fly   200 I-MRRSLFPGDSEIDQLYRIFRTLSTPDETNWPGVTQLPDFKTKFPRWEGTNM---PQPITEHEA 260
            . ..|.||||:...|||.||||.|.||.|..||.:|:|||:| .:|.:..|..   ..|......
Mouse   196 ANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPAMTKLPDYK-PYPMYPATTSLVNVVPKLNATG 259

  Fly   261 HELIMSMLCYDPNLRISAKDALQHAYF 287
            .:|:.::|..:|..||||::||||.||
Mouse   260 RDLLQNLLKCNPVQRISAEEALQHPYF 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk2NP_001163666.1 PLN00009 5..293 CDD:177649 145/287 (51%)
STKc_CDK1_CdkB_like 8..287 CDD:270829 143/282 (51%)
Cdk5NP_031694.1 STKc_CDK5 3..286 CDD:143344 143/283 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 1 1.000 - - FOG0000411
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100334
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R185
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.