DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk2 and CDK2

DIOPT Version :9

Sequence 1:NP_001163666.1 Gene:Cdk2 / 42453 FlyBaseID:FBgn0004107 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_011536034.1 Gene:CDK2 / 1017 HGNCID:1771 Length:346 Species:Homo sapiens


Alignment Length:346 Identity:193/346 - (55%)
Similarity:235/346 - (67%) Gaps:52/346 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LDNFQRAEKIGEGTYGIVYKARSNSTGQDVALKKIRLEGETEGVPSTAIREISLLKNLKHPNVVQ 69
            ::|||:.|||||||||:|||||:..||:.||||||||:.|||||||||||||||||.|.|||:|:
Human     1 MENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVK 65

  Fly    70 LFDVVISGNNLYMIFEYLNMDLKKLMDKKKDVFTP-QLIKSYMHQILDAVGFCHTNRILHRDLKP 133
            |.||:.:.|.||::||:|:.||||.||.......| .|||||:.|:|..:.|||::|:|||||||
Human    66 LLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKP 130

  Fly   134 QNLLVDTAGKIKLADFGLARAFNVPMRAYTHEVVTLWYRAPEILLGTKFYSTGVDIWSLGCIFSE 198
            ||||::|.|.||||||||||||.||:|.||||||||||||||||||.|:|||.||||||||||:|
Human   131 QNLLINTEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAE 195

  Fly   199 M------------------------------------------------IMRRSLFPGDSEIDQL 215
            |                                                :.||:|||||||||||
Human   196 MHLVGTQHHARCCGEHRRNGRQSLCPLCSYLEVAASQGWGMTAVSTPYPVTRRALFPGDSEIDQL 260

  Fly   216 YRIFRTLSTPDETNWPGVTQLPDFKTKFPRWEGTNMPQ--PITEHEAHELIMSMLCYDPNLRISA 278
            :||||||.||||..|||||.:||:|..||:|...:..:  |..:.:...|:..||.||||.||||
Human   261 FRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISA 325

  Fly   279 KDALQHAYFRNV-QHVDHVAL 298
            |.||.|.:|::| :.|.|:.|
Human   326 KAALAHPFFQDVTKPVPHLRL 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk2NP_001163666.1 PLN00009 5..293 CDD:177649 190/339 (56%)
STKc_CDK1_CdkB_like 8..287 CDD:270829 187/329 (57%)
CDK2XP_011536034.1 STKc_CDK2_3 3..334 CDD:270844 188/330 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 388 1.000 Domainoid score I796
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H74409
Inparanoid 1 1.050 395 1.000 Inparanoid score I1973
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 1 1.000 - - FOG0000411
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100334
Panther 1 1.100 - - LDO PTHR24056
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R185
SonicParanoid 1 1.000 - - X960
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.860

Return to query results.
Submit another query.