DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oct-TyrR and HTR1A

DIOPT Version :9

Sequence 1:NP_001163494.1 Gene:Oct-TyrR / 42452 FlyBaseID:FBgn0004514 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_000515.2 Gene:HTR1A / 3350 HGNCID:5286 Length:422 Species:Homo sapiens


Alignment Length:492 Identity:164/492 - (33%)
Similarity:239/492 - (48%) Gaps:116/492 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 LLTALVLSVIIVLTIIGNILVILSVFTYKPLRIVQNFFIVSLAVADLTVALLVLPFNVAYSILGR 174
            ::|:|:|..:|...::||..|:.::...:.|:.|.|:.|.||||.||.|::||||....|.:|.:
Human    37 VITSLLLGTLIFCAVLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNK 101

  Fly   175 WEFGIHLCKLWLTCDVLCCTSSILNLCAIALDRYWAITDPINYAQKRTVGRVLLLISGVWLLSLL 239
            |..|...|.|::..||||||||||:||||||||||||||||:|..|||..|...|||..||:..|
Human   102 WTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFL 166

  Fly   240 ISSPPLIGWNDWPDEFTSATPCELTSQRGYVIYSSLGSFFIPLAIMTIVYIEIFVATRRRLRERA 304
            ||.||::||.. |::.:....|.::...||.|||:.|:|:|||.:|.::|..||.|.|.|:|:  
Human   167 ISIPPMLGWRT-PEDRSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRK-- 228

  Fly   305 RANKLNTIALKSTELEPMANSSPVAASNSGSKSRLLASWLCCGRDRAQFATPMIQNDQESISSET 369
                    .:|..|             .:|:.:|..||                           
Human   229 --------TVKKVE-------------KTGADTRHGAS--------------------------- 245

  Fly   370 HQPQDSSKAGPHGNSDPQQQHVVVLVKKSRRAKTKDSIKHGKTRGGRKSQSSSTCEPHGEQQLLP 434
              |....|...:|.|..:...:.|..|                .||      :.|.....:|   
Human   246 --PAPQPKKSVNGESGSRNWRLGVESK----------------AGG------ALCANGAVRQ--- 283

  Fly   435 AGGDGGSCQPGGGHS-GGGKSDAEISTESGSDPKGCIQVCVTQADEQTSLKLTPPQSSTGVAAVS 498
             |.||.:.:....|. |..|....:.:|:|..|  |......:.:|:.:                
Human   284 -GDDGAALEVIEVHRVGNSKEHLPLPSEAGPTP--CAPASFERKNERNA---------------- 329

  Fly   499 VTPLQKKTSGVNQFIEEKQKISLSKERRAARTLGIIMGVFVICWLPFFLMYVILPFCQTCC--PT 561
                           |.|:|::|::||:..:|||||||.|::||||||::.::||||::.|  ||
Human   330 ---------------EAKRKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCESSCHMPT 379

  Fly   562 NKFKNFITWLGYINSGLNPVIYTIFNLDYRRAFKRLL 598
             .....|.||||.||.||||||..||.|::.|||:::
Human   380 -LLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKII 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Oct-TyrRNP_001163494.1 Zinc_peptidase_like <113..244 CDD:301362 66/130 (51%)
7tm_1 126..>293 CDD:278431 81/166 (49%)
HTR1ANP_000515.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
7tm_4 48..>169 CDD:304433 62/120 (52%)
7tm_1 53..400 CDD:278431 152/459 (33%)
Agonist binding. /evidence=ECO:0000250 112..121 4/8 (50%)
DRY motif, important for ligand-induced conformation changes. /evidence=ECO:0000250 133..135 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 235..262 8/55 (15%)
Agonist binding. /evidence=ECO:0000250 358..362 3/3 (100%)
NPxxY motif, important for ligand-induced conformation changes and signaling. /evidence=ECO:0000250 396..400 3/3 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BCYC
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002041
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104614
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.