DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oct-TyrR and Htr1d

DIOPT Version :9

Sequence 1:NP_001163494.1 Gene:Oct-TyrR / 42452 FlyBaseID:FBgn0004514 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_036984.1 Gene:Htr1d / 25323 RGDID:2847 Length:374 Species:Rattus norvegicus


Alignment Length:529 Identity:158/529 - (29%)
Similarity:230/529 - (43%) Gaps:186/529 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 EGAVEELHASILGLQLAVPEWE-ALLTAL------VLSVIIVLTIIGNILVILSVFTYKPLRIVQ 144
            ||..:|  ||...|. |...|: .:|.||      |||:|.:.|::.|..|:.::...|.|....
  Rat     9 EGLPQE--ASNRSLN-ATGAWDPEVLQALRISLVVVLSIITLATVLSNAFVLTTILLTKKLHTPA 70

  Fly   145 NFFIVSLAVADLTVALLVLPFNVAYSILGRWEFGIHLCKLWLTCDVLCCTSSILNLCAIALDRYW 209
            |:.|.|||..||.|::||:|.::||:....|.||..||.:|::.|:.|||:|||:||.|||||||
  Rat    71 NYLIGSLATTDLLVSILVMPISIAYTTTRTWNFGQILCDIWVSSDITCCTASILHLCVIALDRYW 135

  Fly   210 AITDPINYAQKRTVGRVLLLISGVWLLSLLISSPPLIGWNDWPDEFTSATPCE-------LTSQR 267
            ||||.:.|:::||.|....:|:.||.:|:.||.|||. |.       .||..|       .|||.
  Rat   136 AITDALEYSKRRTAGHAAAMIAAVWAISICISIPPLF-WR-------QATAHEEMSDCLVNTSQI 192

  Fly   268 GYVIYSSLGSFFIPLAIMTIVYIEIFVATRRRLRERARANKLNTIALKSTELEPMANSSPVAASN 332
            .|.|||:.|:|:||..::.|:|..|:||.|.|:        ||..:|.....    .::.:...:
  Rat   193 SYTIYSTCGAFYIPSILLIILYGRIYVAARSRI--------LNPPSLYGKRF----TTAQLITGS 245

  Fly   333 SGSKSRLLASWLCCGRDRAQFATPMIQNDQESISSETHQPQDSSKAGPHGNSDPQQQHVVVLVKK 397
            :||.       ||                  |::...|                           
  Rat   246 AGSS-------LC------------------SLNPSLH--------------------------- 258

  Fly   398 SRRAKTKDSIKHGKTRGGRKSQSSSTCEPHGEQQLLPAGGDGGSCQPGGGHSGGGKSDAEISTES 462
                                       |.|                                |.:
  Rat   259 ---------------------------ESH--------------------------------THT 264

  Fly   463 GSDPKGCIQVCVTQADEQTSLKLTPPQSSTGVAAVSVTPLQKKTSGVNQFIEEKQKISLSKERRA 527
            ...|....||.:..||.                                 |.|:::||.::||:|
  Rat   265 VGSPLFFNQVKIKLADS---------------------------------ILERKRISAARERKA 296

  Fly   528 ARTLGIIMGVFVICWLPFFLMYVILPFCQTCC---PTNKFKNFITWLGYINSGLNPVIYTIFNLD 589
            .:|||||:|.|:|||||||::.::||.|:..|   |.  ..:|.|||||:||.:||||||:||.|
  Rat   297 TKTLGIILGAFIICWLPFFVVSLVLPICRDSCWIHPA--LFDFFTWLGYLNSLINPVIYTVFNED 359

  Fly   590 YRRAFKRLL 598
            :|:||:|::
  Rat   360 FRQAFQRVV 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Oct-TyrRNP_001163494.1 Zinc_peptidase_like <113..244 CDD:301362 60/136 (44%)
7tm_1 126..>293 CDD:278431 73/173 (42%)
Htr1dNP_036984.1 7tmA_5-HT1B_1D 32..364 CDD:320455 146/497 (29%)
TM helix 1 38..62 CDD:320455 7/23 (30%)
TM helix 2 71..93 CDD:320455 11/21 (52%)
TM helix 3 109..131 CDD:320455 11/21 (52%)
Agonist binding. /evidence=ECO:0000250 111..120 3/8 (38%)
DRY motif, important for ligand-induced conformation changes. /evidence=ECO:0000250 132..134 1/1 (100%)
TM helix 4 154..170 CDD:320455 6/15 (40%)
TM helix 5 192..215 CDD:320455 9/22 (41%)
TM helix 6 297..319 CDD:320455 14/21 (67%)
Agonist binding. /evidence=ECO:0000250 311..315 3/3 (100%)
TM helix 7 332..357 CDD:320455 15/26 (58%)
NPxxY motif, important for ligand-induced conformation changes and signaling. /evidence=ECO:0000250 349..353 3/3 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H20240
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.