DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4000 and pqn-67

DIOPT Version :9

Sequence 1:NP_650906.1 Gene:CG4000 / 42451 FlyBaseID:FBgn0038820 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_506231.1 Gene:pqn-67 / 179773 WormBaseID:WBGene00004150 Length:695 Species:Caenorhabditis elegans


Alignment Length:258 Identity:64/258 - (24%)
Similarity:87/258 - (33%) Gaps:76/258 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VVPVGLPAVGTYLLSPPVVLLVQPPPPPPEDDGSYKPPSP---PEDGSWQPQPGLEGEYSDPE-- 82
            |.|.|||.:              |.|.|......::|..|   ..||. :.:...:||...|.  
 Worm   252 VPPAGLPRI--------------PEPSPVIKSRPFRPNRPFGRLNDGE-EDEGNTDGENRGPRNP 301

  Fly    83 ---LSQSG--SGSITASDAGAAALSLVASQSV---------DAQDAPAPAEAGGAGGAG-QAGQA 132
               .:|:|  .|.|.:....:...:.:.|.|:         |..|.....:..|..|.| ..|:.
 Worm   302 IVPFNQAGPFQGPIVSPKVESMIENSLGSTSMPNPNRKSKYDEDDDYEDGDGNGCNGNGCSYGRR 366

  Fly   133 GALLGGAGGAGGA--------GGGGSAGGGGGGGGGGGGGTATSGQSGDSGQPGAP--------- 180
            |   ||...:||.        |||.:.|.|....||...|. ..|.|.:.|..|.|         
 Worm   367 G---GGNQNSGGGCEMNCRRNGGGNNDGCGCNRRGGNNNGN-RGGNSQECGNGGCPWNGNNNNNN 427

  Fly   181 ----SPAGPQPDG--EDGADGADGPDGPDGSKGGKGG------------KGGKGARNGAGGGG 225
                .|..|:||.  |:..:|.:...|  ||.||..|            ||.|..:...||||
 Worm   428 NNGNRPRRPRPDTDYEENENGCEADLG--GSNGGGNGPVPPIPEPKPLCKGLKFKKTANGGGG 488



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2ASSX
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.