DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4000 and col-10

DIOPT Version :9

Sequence 1:NP_650906.1 Gene:CG4000 / 42451 FlyBaseID:FBgn0038820 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001370309.1 Gene:col-10 / 179298 WormBaseID:WBGene00000599 Length:294 Species:Caenorhabditis elegans


Alignment Length:230 Identity:80/230 - (34%)
Similarity:92/230 - (40%) Gaps:34/230 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GLPAVGTYLLSPPVVLLVQPPPPPPEDDGSYKPPSPPEDGSWQPQPGLEGEYSDPELSQSGSGSI 91
            ||||   :....|    .:|..||       .||.||      .|||..|....|    ...|..
 Worm    87 GLPA---WCQCEP----TKPTCPP-------GPPGPP------GQPGAPGTPGAP----GPKGDD 127

  Fly    92 TASDAGAAALSLVASQSVDAQDAPA-PA-EAGGAGGAGQAGQAGALLGGAGGAGGAGGGGSAGGG 154
            ..:.......:.|:...|...:.|| || ..|.||.||..||.|| .|.||..|..|..|:.|..
 Worm   128 NTATFAPLTCAPVSQDCVKCPEGPAGPAGPEGPAGPAGPDGQPGA-PGNAGNPGSDGQPGAPGDN 191

  Fly   155 GGGGG----GGGGGTATSGQ--SGDSGQPGAPSPAGPQ-PDGEDGADGADGPDGPDGSKGGKGGK 212
            |..|.    |..|.....||  ||..|.||||..|||. |.|:|||.|.||..||.|..|..|..
 Worm   192 GQDGAPGQDGQPGAPGQDGQRGSGAPGGPGAPGNAGPAGPAGQDGAPGQDGQPGPAGPAGQDGAP 256

  Fly   213 GGKGARNGAGGGGGAGGAAPQPAPAAIPVQAAVLI 247
            |..|:....|..||.|......|..|.|.::||.:
 Worm   257 GNAGSDGQPGAPGGPGLPGNDAAYCACPPRSAVFV 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4000NP_650906.1 None
col-10NP_001370309.1 Col_cuticle_N 4..56 CDD:198156
PRK07764 <148..279 CDD:236090 55/131 (42%)
Collagen 150..206 CDD:396114 24/56 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28608
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.