DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr92F and CG34462

DIOPT Version :10

Sequence 1:NP_650905.2 Gene:Cpr92F / 42450 FlyBaseID:FBgn0038819 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001097548.1 Gene:CG34462 / 5740319 FlyBaseID:FBgn0085491 Length:312 Species:Drosophila melanogaster


Alignment Length:43 Identity:13/43 - (30%)
Similarity:20/43 - (46%) Gaps:3/43 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 EISIGKPVTIECVRIVAKTEHDRSALQGYRFVSPTVIEVSVAE 138
            |.||....::.|::  .:.|..:..||..| |.|.|.|..:.|
  Fly    28 EESIQMRNSLSCLK--EELERTKQELQKLR-VDPGVNETKLDE 67

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr92FNP_650905.2 Chitin_bind_4 37..84 CDD:459790
CG34462NP_001097548.1 Chitin_bind_4 62..113 CDD:459790 2/6 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.