DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr92F and Cpr92A

DIOPT Version :9

Sequence 1:NP_650905.2 Gene:Cpr92F / 42450 FlyBaseID:FBgn0038819 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_650813.2 Gene:Cpr92A / 42333 FlyBaseID:FBgn0038714 Length:245 Species:Drosophila melanogaster


Alignment Length:252 Identity:80/252 - (31%)
Similarity:93/252 - (36%) Gaps:85/252 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ASWHGAVSTQY--------QHLDPHSHTYSYGY-------ADPNSQKHETRSHDGTTHGSYSYVD 66
            |..||.:...|        :..|| ...||:||       .|..|| |||| |.....||||.||
  Fly    41 APQHGPLPGPYVAPKPAAPEPYDP-DPKYSFGYDIQDGYTGDLKSQ-HETR-HGDVVKGSYSVVD 102

  Fly    67 GHGHVQSVSYTADPHHGFNAVGTNLP---QAPQVHAAPVYAAAHAHGAYAPYAHGPIHIPVLT-- 126
            ..|..::|.||||||||||||....|   :|| .|.|||.|.|.|.   .|..:||...|.|.  
  Fly   103 PDGTKRTVDYTADPHHGFNAVVRKEPLAYKAP-AHLAPVVAPAPAP---VPAHYGPAPAPPLPPV 163

  Fly   127 ---------------HGGVPVDTPEVQHAKAAHAAAHAAAAHNAGGHHLYKRSIYGGGWAYGQAA 176
                           |.|.|...|       ..|.|.|.|                         
  Fly   164 PKAPLLSYPLALGPYHRGAPAPAP-------GPAPAPAPA------------------------- 196

  Fly   177 HVPLTHGGVPVDTPDVQAAKAEHYAAHAKALGHVAHAH---GAPVETPEVQHAKAAH 230
              |::   |||.||.:.:|   |:.|...||.|..:||   ..|...|...||...|
  Fly   197 --PVS---VPVATPVLPSA---HFHAAYPALAHSPYAHYPAPGPAPAPVEPHAYYHH 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr92FNP_650905.2 Chitin_bind_4 37..84 CDD:278791 27/53 (51%)
Cpr92ANP_650813.2 PHA03185 <21..77 CDD:177553 10/36 (28%)
Chitin_bind_4 68..120 CDD:278791 27/53 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.