DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr92F and Ccp84Aa

DIOPT Version :9

Sequence 1:NP_650905.2 Gene:Cpr92F / 42450 FlyBaseID:FBgn0038819 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_649683.1 Gene:Ccp84Aa / 40825 FlyBaseID:FBgn0004783 Length:205 Species:Drosophila melanogaster


Alignment Length:268 Identity:71/268 - (26%)
Similarity:88/268 - (32%) Gaps:105/268 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FIAAALLISTVSAS---------WHG--AVSTQYQH----------------LDPH-SHTYSYGY 41
            |:.|...::..||.         :|.  ||:| |.|                .||| .:.:|||.
  Fly     5 FVFALAFVAVASAGYAPIAAPQVYHAAPAVAT-YAHAPVAVAQKVVVKAAEEYDPHPQYRFSYGV 68

  Fly    42 AD--PNSQKHETRSHDG-TTHGSYSYVDGHGHVQSVSYTADPHHGFNAVGTNLPQAPQVHAAPVY 103
            .|  ....|.:....|| ...|.||.:|..|:.:.|.|||||.:|||||....|....|..|||.
  Fly    69 DDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRIVQYTADPINGFNAVVNREPLVKAVAVAPVV 133

  Fly   104 AAAHAHGAYAPYAHGPIHIPVLTHGGVPVDTPEVQHAKAAHAAAHAAAAHNAGGHHLYKRSIYGG 168
            ..                          |..|..|:  ||.|.||.||                 
  Fly   134 KT--------------------------VAAPVAQY--AAPAVAHYAA----------------- 153

  Fly   169 GWAYGQAAHVPLTHGGVPVDTPDV--QAAKAEHYAAHA--KALGHVAHAHGAPVETPEVQHAKAA 229
                                 |.|  ..|...||||.|  |.:..||| :.||  .....:|...
  Fly   154 ---------------------PAVVKTVAPVAHYAAPAVVKTVAPVAH-YAAP--AAYATYAAPT 194

  Fly   230 HFAAHAAA 237
            |:||.|.|
  Fly   195 HYAAPAVA 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr92FNP_650905.2 Chitin_bind_4 37..84 CDD:278791 18/49 (37%)
Ccp84AaNP_649683.1 Chitin_bind_4 62..114 CDD:278791 18/51 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453160
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.