DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr92F and Ccp84Ac

DIOPT Version :9

Sequence 1:NP_650905.2 Gene:Cpr92F / 42450 FlyBaseID:FBgn0038819 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_649681.1 Gene:Ccp84Ac / 40823 FlyBaseID:FBgn0004781 Length:217 Species:Drosophila melanogaster


Alignment Length:231 Identity:66/231 - (28%)
Similarity:81/231 - (35%) Gaps:78/231 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QYQH-LDPHSH---------TYSYGY----ADPNSQKHETRSHDG-TTHGSYSYVDGHGHVQSVS 75
            |.|| :.||.|         .|::.|    |.....|.:..|.|| ...|.||..|..|..::|.
  Fly    44 QKQHEIHPHGHEVYPDDPHPKYNFAYDVQDALSGDSKSQVESRDGDVVQGEYSLDDADGFRRTVK 108

  Fly    76 YTADPHHGFNAVGTNLPQAPQVHAAPVYAAAHAHGAYAPYAHGPIHIPVLTHGGVPVDTPEVQHA 140
            ||||..:|||||         ||..|:   ||.|......|      ||..|             
  Fly   109 YTADSVNGFNAV---------VHREPL---AHVHHKVVAAA------PVQYH------------- 142

  Fly   141 KAAHAAAHAAAAHNAGGHHLYKRSIYGGGWAYGQAAHVPLTHGGVPVDTPDVQAAKAEHYAAHAK 205
               ||.|.|||...:              :|....|:|..|:.......|    |.|.|.|...:
  Fly   143 ---HAPAAAAAVIKS--------------YASPSQAYVAPTYAAPAYTAP----AYATHQAEQPQ 186

  Fly   206 ALGHVAHAHGAPVETPEVQHAKAAHFAAHAAARSGH 241
            ...|..| |.|..|:|  .||:|||        .||
  Fly   187 EREHQQH-HYASYESP--AHAQAAH--------EGH 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr92FNP_650905.2 Chitin_bind_4 37..84 CDD:278791 17/51 (33%)
Ccp84AcNP_649681.1 Chitin_bind_4 65..117 CDD:278791 17/51 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453170
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.