DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr92F and Ccp84Ae

DIOPT Version :9

Sequence 1:NP_650905.2 Gene:Cpr92F / 42450 FlyBaseID:FBgn0038819 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_649679.1 Gene:Ccp84Ae / 40821 FlyBaseID:FBgn0004779 Length:208 Species:Drosophila melanogaster


Alignment Length:176 Identity:54/176 - (30%)
Similarity:77/176 - (43%) Gaps:29/176 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IAAALLIS-TVSASWHGAV-------------------STQYQHLDPH-SHTYSYGYADPNS--Q 47
            :||.::|: .:.|..||||                   :.:.:.:||| .:||||...|..|  .
  Fly     1 MAAKIVIALALFAVAHGAVLRTAAPVAVASAPVPVLAKTVELEEVDPHPQYTYSYDVQDTLSGDN 65

  Fly    48 KHETRSHDG-TTHGSYSYVDGHGHVQSVSYTADPHHGFNAVGTNLPQAPQVHAAPVYAAAHAHGA 111
            |......|| ...|.||.:|..|..::|:||||..:|||||....|.|..|.|.|:...|.....
  Fly    66 KGHVEERDGDVVRGEYSLIDADGFKRTVTYTADSINGFNAVVRREPLAAVVAAEPLLKVAAPLVK 130

  Fly   112 YAPYAH-GPIHI----PVLTHGGVPVDTPEVQHAKAAHAAAHAAAA 152
            .||.|. .|:.:    |::....|.|..|.::.|..|.||....:|
  Fly   131 AAPVAPIAPVALAAPAPIVRSAPVAVAAPLIKSAPLAVAAPFVRSA 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr92FNP_650905.2 Chitin_bind_4 37..84 CDD:278791 18/49 (37%)
Ccp84AeNP_649679.1 Chitin_bind_4 51..103 CDD:278791 19/51 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453154
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.