DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr92F and Cpr72Eb

DIOPT Version :9

Sequence 1:NP_650905.2 Gene:Cpr92F / 42450 FlyBaseID:FBgn0038819 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_648883.1 Gene:Cpr72Eb / 39815 FlyBaseID:FBgn0036618 Length:217 Species:Drosophila melanogaster


Alignment Length:211 Identity:59/211 - (27%)
Similarity:82/211 - (38%) Gaps:74/211 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FFIAAALLISTVSAS------WHGAVST-----QYQHLDPHSHTYSYGYADPNSQKHETRSHDGT 57
            :|:...|:.:|:..:      .:|...|     ||.|.|.|.. |:|||..|...|||||:.||.
  Fly     2 YFLNLCLICTTIGLAVGSPTLEYGPPPTSDTISQYHHQDEHGQ-YAYGYMAPLYSKHETRTVDGV 65

  Fly    58 THGSYSYVDGHGHVQSVSYTADPHHGFNAVGTNLP--QAPQVHAAPVYAAAHAHGAYAPYAHGPI 120
            ..|::|::|.:|..|:|.|.||. .||: |.:|||  ||.|                        
  Fly    66 IRGTFSHIDANGETQTVDYVADA-EGFH-VTSNLPNQQANQ------------------------ 104

  Fly   121 HIPVLTHGGVPVDTPEVQHAKAAHAAAHAAAAHNAGGHHLYKRSIYGGGWAYGQAAHVPLTHGGV 185
                        :||||...:..|..||..|.....|.:                     :.|..
  Fly   105 ------------ETPEVAALRTQHLEAHNQAKLRLAGDY---------------------SVGPQ 136

  Fly   186 PV-DTPDVQAAKAEHY 200
            || |||:|.|||...:
  Fly   137 PVRDTPEVAAAKVAFF 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr92FNP_650905.2 Chitin_bind_4 37..84 CDD:278791 21/46 (46%)
Cpr72EbNP_648883.1 Chitin_bind_4 45..91 CDD:278791 21/46 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453276
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.