DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr92F and Cpr67B

DIOPT Version :9

Sequence 1:NP_650905.2 Gene:Cpr92F / 42450 FlyBaseID:FBgn0038819 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_648306.1 Gene:Cpr67B / 39081 FlyBaseID:FBgn0035985 Length:260 Species:Drosophila melanogaster


Alignment Length:225 Identity:51/225 - (22%)
Similarity:67/225 - (29%) Gaps:100/225 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FIAAALLISTV---------------------SASWHGAVSTQY--------------------- 27
            :|.||||::|:                     ||...|....:|                     
  Fly     4 YILAALLLATLASGENIFKINITPEEAQQFLNSAQLRGIGDIEYAPKTGENPLPEARNEKGEFVY 68

  Fly    28 -------------QHLDPHSH-------TYSYGYADPNSQKHETRSHDGTTHGSYSYVDGHGHVQ 72
                         :|.|.|.:       .::|||.|.|..|:|.|...|...|||.||..||...
  Fly    69 MGRVIEHPEEYVEEHYDAHQYHGQDGLGQFAYGYRDWNQGKNEKRDETGKVTGSYKYVQPHGRDF 133

  Fly    73 SVSYTADPHHGFNAVGTNLP--------QAPQV-------------------HAAPVYAAAH--- 107
            ..:|.|| ..||: |..|.|        :.|.|                   |....|||.:   
  Fly   134 VANYYAD-KTGFH-VEDNRPAHLKLPATKTPAVLKAEEEHFKLWGELAAAAGHNPDPYAAEYQQE 196

  Fly   108 -----AHGAYAPYAH-GPIHIPVLTHGGVP 131
                 ....|.||.| .|.::|.....|.|
  Fly   197 GRYQPTEPEYQPYVHEEPPYVPGPEETGEP 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr92FNP_650905.2 Chitin_bind_4 37..84 CDD:278791 19/46 (41%)
Cpr67BNP_648306.1 Chitin_bind_4 <111..144 CDD:278791 13/33 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444800
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.