DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr92F and Cpr64Ad

DIOPT Version :9

Sequence 1:NP_650905.2 Gene:Cpr92F / 42450 FlyBaseID:FBgn0038819 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_647875.1 Gene:Cpr64Ad / 38511 FlyBaseID:FBgn0035513 Length:247 Species:Drosophila melanogaster


Alignment Length:132 Identity:44/132 - (33%)
Similarity:60/132 - (45%) Gaps:26/132 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 AALLISTVSASWHGAVSTQYQHLDPHSHTYSYGY-------ADPNSQKHETRSHDGTTHGSYSYV 65
            ||.|.:.|:|    .::|:.  :|.|.. |.:.|       .|..:|: |||..| ...||||.:
  Fly   124 AAPLAAPVAA----PIATEI--VDAHPQ-YKFAYDVQDTLTGDSKTQE-ETRDGD-VVRGSYSLI 179

  Fly    66 DGHGHVQSVSYTADPHHGFNAVGTNLPQAPQVHAAPVYAAAHAHGAYAPYAHGPIHIPVLTHGGV 130
            :..|..:.|||.||..:|||||   :.:...|..||| |...|....||.|      ||:.....
  Fly   180 EPDGSRRIVSYYADSINGFNAV---VQKDVPVAVAPV-APVLAKTVAAPVA------PVVAAAPA 234

  Fly   131 PV 132
            ||
  Fly   235 PV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr92FNP_650905.2 Chitin_bind_4 37..84 CDD:278791 18/53 (34%)
Cpr64AdNP_647875.1 Chitin_bind_4 146..198 CDD:306811 18/53 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.