DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr92F and Cpr56F

DIOPT Version :9

Sequence 1:NP_650905.2 Gene:Cpr92F / 42450 FlyBaseID:FBgn0038819 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_611470.1 Gene:Cpr56F / 37299 FlyBaseID:FBgn0034499 Length:217 Species:Drosophila melanogaster


Alignment Length:144 Identity:33/144 - (22%)
Similarity:49/144 - (34%) Gaps:48/144 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 HAVSPINHGGYHVPVIHNGVPVDT--PEVQ--HAKAAHYAALSQASAHGGASHGSWDDGSYDGRW 301
            ||..|:....|..|......|.:.  |..|  .:.:::|....:|..:|||              
  Fly    18 HAEPPVPQNQYLPPNQSPQAPSNNYLPPTQGYQSPSSNYLPPQRAGGNGGA-------------- 68

  Fly   302 EQSHSSHNSYASGYAHKGPIHIPVIHNGVPVEPAEVQHARAAHLNALAAAGHGAPASHGSYYGGN 366
                 ..|||                 |.|:.|.:.|:...|...|:...|:|  ..:|.|.|||
  Fly    69 -----PSNSY-----------------GAPIAPPQGQYGAPALTGAIFKGGNG--NGNGGYGGGN 109

  Fly   367 GH------EDDGQY 374
            |:      .|:.||
  Fly   110 GNGNGYGQRDEEQY 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr92FNP_650905.2 Chitin_bind_4 37..84 CDD:278791
Cpr56FNP_611470.1 Chitin_bind_4 128..179 CDD:278791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.