DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr92F and resilin

DIOPT Version :9

Sequence 1:NP_650905.2 Gene:Cpr92F / 42450 FlyBaseID:FBgn0038819 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_611157.1 Gene:resilin / 36880 FlyBaseID:FBgn0034157 Length:620 Species:Drosophila melanogaster


Alignment Length:382 Identity:84/382 - (21%)
Similarity:120/382 - (31%) Gaps:103/382 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PHSHTY-SYGYADPNSQKHETRSHDGTTHG---SYSY-VDGHGHVQSV---SYTADPHHGFNAVG 88
            |.|.:| :.|.:.|..:..::....|..:|   |.|| ..|.|..|..   .|...|...:.|.|
  Fly    28 PPSDSYGAPGQSGPGGRPSDSYGAPGGGNGGRPSDSYGAPGQGQGQGQGQGGYAGKPSDTYGAPG 92

  Fly    89 ---TNLPQAPQVHAAPVYAAAHAHGAYAPYAHGPIHIPVLTHGGVPVDTPEVQ---------HAK 141
               .|..:....:.||    ...:|......:|   .|...:||.|.||....         ...
  Fly    93 GGNGNGGRPSSSYGAP----GGGNGGRPSDTYG---APGGGNGGRPSDTYGAPGGGGNGNGGRPS 150

  Fly   142 AAHAAAHAAAAHNAGGHHLYKRSIYGGGWAYGQAAHVPLTHGGVPVDTPDVQAAKAEHYAAHAKA 206
            :::.|......:..||.........|||            :||.|.||          |.|....
  Fly   151 SSYGAPGQGQGNGNGGRSSSSYGAPGGG------------NGGRPSDT----------YGAPGGG 193

  Fly   207 LGHVAHAHGAPVETPEVQHAKAAHFAAHAAARSGHAVSPINHGG-----YHVPVIHN-GVPVDTP 265
            .|      |.|.:|             :.|...|      |:||     |..|...| |.|.||.
  Fly   194 NG------GRPSDT-------------YGAPGGG------NNGGRPSSSYGAPGGGNGGRPSDTY 233

  Fly   266 EVQHAKAAHYAALSQASAHGGASHGSWDDGSYDGRWEQSHSS-------HNSYASGYAHKGPIHI 323
            ........:.:....:|::|....|   .|.:.||...|:.:       .:||.:          
  Fly   234 GAPGGGNGNGSGGRPSSSYGAPGQG---QGGFGGRPSDSYGAPGQNQKPSDSYGA---------- 285

  Fly   324 PVIHNGVPVEPAEVQHARAAHLNALAAAGHGAPASHGSYYGGNGHEDDGQYHAHYDH 380
            |...||....|:....|..:......:..:|.||| ||..||.|....|  .|.||:
  Fly   286 PGSGNGNGGRPSSSYGAPGSGPGGRPSDSYGPPAS-GSGAGGAGGSGPG--GADYDN 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr92FNP_650905.2 Chitin_bind_4 37..84 CDD:278791 13/54 (24%)
resilinNP_611157.1 Chitin_bind_4 345..396 CDD:278791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.