DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr92F and Cpr51A

DIOPT Version :10

Sequence 1:NP_650905.2 Gene:Cpr92F / 42450 FlyBaseID:FBgn0038819 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_610968.1 Gene:Cpr51A / 36613 FlyBaseID:FBgn0033942 Length:144 Species:Drosophila melanogaster


Alignment Length:92 Identity:26/92 - (28%)
Similarity:39/92 - (42%) Gaps:15/92 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKPFFIAAALLISTVSASWHGAVS-------TQYQHLDPHSHTYSYGYA------DPNSQKHETR 52
            |..|.:.|:||::...|:.....|       .:|:.....:..||:..:      |....::|.|
  Fly     1 MYKFVLIASLLVALCMAAPPRQESEAERIEREEYEKYQNENAQYSFNSSVDDKINDGQISRNEER 65

  Fly    53 SHDGTTHGSYSYVDGHGHVQSVSYTAD 79
             ..||..|||||.||... :.|.|.||
  Fly    66 -EGGTVRGSYSYFDGFVK-RRVEYIAD 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr92FNP_650905.2 Chitin_bind_4 37..84 CDD:459790 18/49 (37%)
Cpr51ANP_610968.1 Chitin_bind_4 44..94 CDD:459790 18/49 (37%)

Return to query results.
Submit another query.