DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr92F and Cpr50Cb

DIOPT Version :9

Sequence 1:NP_650905.2 Gene:Cpr92F / 42450 FlyBaseID:FBgn0038819 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_610901.1 Gene:Cpr50Cb / 36525 FlyBaseID:FBgn0033869 Length:178 Species:Drosophila melanogaster


Alignment Length:80 Identity:26/80 - (32%)
Similarity:30/80 - (37%) Gaps:14/80 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 DPHSHT----YSYGYA--DP---NSQKHETRSHDGTTHGSYSYVDGHGHVQSVSYTADPHHGFNA 86
            |.|.|.    |.:.||  ||   |...|:..|......|.|......|..|.|.||||...|::|
  Fly    80 DDHVHVPGMPYDFEYAVQDPETANDYAHKASSDGDVVTGEYRVQMPDGRTQIVRYTADWKTGYHA 144

  Fly    87 -----VGTNLPQAPQ 96
                 .....||.||
  Fly   145 DVSYEGEATYPQGPQ 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr92FNP_650905.2 Chitin_bind_4 37..84 CDD:278791 17/51 (33%)
Cpr50CbNP_610901.1 Chitin_bind_4 90..142 CDD:278791 17/51 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.