DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr92F and CG1850

DIOPT Version :9

Sequence 1:NP_650905.2 Gene:Cpr92F / 42450 FlyBaseID:FBgn0038819 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_610265.1 Gene:CG1850 / 35647 FlyBaseID:FBgn0033154 Length:681 Species:Drosophila melanogaster


Alignment Length:139 Identity:36/139 - (25%)
Similarity:48/139 - (34%) Gaps:47/139 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 PVD-TPDVQAAKAEHYAAHAKALGHVAHAHGAPV--------------------------ETPEV 223
            |:| ||:|:.|:.||.....:||.....|...|.                          |||||
  Fly   305 PIDETPEVKKAREEHLKLFNEALLRQTTAPAEPTLKATTTKNDQPQAFTFPEKKAPQPIQETPEV 369

  Fly   224 QHAKAAHFAAH---------------AAARSGHAVSPINHGGYHVPVIHNGVPV-DTPEVQHAKA 272
            ..|:..|....               ..|.:..|..||    :..|:.....|| |||||:.|:.
  Fly   370 VRAREEHLKQFNEAILRQPVDIQQQPLIATAPFAPQPI----FKSPIAEVPQPVQDTPEVKLARE 430

  Fly   273 AHYAALSQA 281
            .|...|:||
  Fly   431 QHLLLLNQA 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr92FNP_650905.2 Chitin_bind_4 37..84 CDD:278791
CG1850NP_610265.1 GBP_C <452..523 CDD:303769
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQN9
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.