DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr92F and Crys

DIOPT Version :10

Sequence 1:NP_650905.2 Gene:Cpr92F / 42450 FlyBaseID:FBgn0038819 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_476906.1 Gene:Crys / 34604 FlyBaseID:FBgn0005664 Length:477 Species:Drosophila melanogaster


Alignment Length:70 Identity:23/70 - (32%)
Similarity:32/70 - (45%) Gaps:12/70 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LDPHSH-------TYSYGYADPNS----QKHETRSHDG-TTHGSYSYVDGHGHVQSVSYTADPHH 82
            |.|:|:       .||:.|...:|    .|.:....|| ...|.||.::..|..:.|.||||...
  Fly    63 LAPNSNEDYDTRPQYSFAYDVRDSLTGDDKRQEEKRDGDLVKGQYSLIEPDGTRRIVEYTADDVS 127

  Fly    83 GFNAV 87
            ||||:
  Fly   128 GFNAI 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr92FNP_650905.2 Chitin_bind_4 37..84 CDD:459790 16/51 (31%)
CrysNP_476906.1 Chitin_bind_4 77..129 CDD:459790 16/51 (31%)

Return to query results.
Submit another query.