DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lrrk and RIPK4

DIOPT Version :9

Sequence 1:NP_001262772.1 Gene:Lrrk / 42447 FlyBaseID:FBgn0038816 Length:2513 Species:Drosophila melanogaster
Sequence 2:NP_065690.2 Gene:RIPK4 / 54101 HGNCID:496 Length:784 Species:Homo sapiens


Alignment Length:784 Identity:176/784 - (22%)
Similarity:287/784 - (36%) Gaps:218/784 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1802 LGRGAFGFVFKANCKVRGARSFKPVAMKMLQPVPPGARAKESALMAFKVAVGKWDRDPLQHSCKA 1866
            :|.|.||.|:    |||.......:|:|....:....|.:...|...|                 
Human    28 VGSGGFGQVY----KVRHVHWKTWLAIKCSPSLHVDDRERMELLEEAK----------------- 71

  Fly  1867 YCTARQELAVLLTLKHPNIVPLVGICIKPLALVLELAPLGGLDALLR--------HYRRSGAHMG 1923
                :.|:|     |...|:|:.|||.:|:.||:|....|.|:.||.        .:|       
Human    72 ----KMEMA-----KFRYILPVYGICREPVGLVMEYMETGSLEKLLASEPLPWDLRFR------- 120

  Fly  1924 PHTFQTLVLQAARAIEYLH--RRRIIYRDLKSENVLVWELPQPHTEDSPRNLVHIKIADYGISRQ 1986
                  ::.:.|..:.:||  ...:::.|||..|:|:    ..|        .|:||:|:|:::.
Human   121 ------IIHETAVGMNFLHCMAPPLLHLDLKPANILL----DAH--------YHVKISDFGLAKC 167

  Fly  1987 TAPS-----GAKGFGGTEGFMAPEIIRYNGEEEYTEKVDCFSFGMFIYENISLRQPFEGHESIKE 2046
            ...|     ...|..||..::.||.|| .....:..|.|.:||.:.|:..::.::||...::|..
Human   168 NGLSHSHDLSMDGLFGTIAYLPPERIR-EKSRLFDTKHDVYSFAIVIWGVLTQKKPFADEKNILH 231

  Fly  2047 C---ILEGSRPALTQRETQFPTCC---LDLMVLCWHEQPRRRPTASQIVS----ILSAP-----E 2096
            .   :::|.||.|.......|..|   :.||..||...||.|||..:|.|    :...|     |
Human   232 IMVKVVKGHRPELPPVCRARPRACSHLIRLMQRCWQGDPRVRPTFQEITSETEDLCEKPDDEVKE 296

  Fly  2097 CIHLLDVVAMPHSEKIV---------------------------CGVFQSLVGMGDDERCGLELW 2134
            ..|.|||.:.|.....|                           .||.|::.|..:..|...|..
Human   297 TAHDLDVKSPPEPRSEVVPARLKRASAPTFDNDYSLSELLSQLDSGVSQAVEGPEELSRSSSESK 361

  Fly  2135 LPSFG-----SRIDILDC--SPSGSLLQCNSISCSPQPQVAPPKTPENGANSRARSAQRLPKMNM 2192
            |||.|     |.:..:|.  |..|||    |:|...:|..:...|.:            :.|..:
Human   362 LPSSGSGKRLSGVSSVDSAFSSRGSL----SLSFEREPSTSDLGTTD------------VQKKKL 410

  Fly  2193 LCCCLVGEAIWMGDVSGNLHAYSTSTYAHLFSYMLDPNIKSAVISLVYMEKIARVAVGTHNGRVF 2257
            :      :||..||.|            .|...:...::..|:.|...:..:| |..|......:
Human   411 V------DAIVSGDTS------------KLMKILQPQDVDLALDSGASLLHLA-VEAGQEECAKW 456

  Fly  2258 LVDATQMPSNCAFAEGSFVLTEICSGFVLHAACSVVVDGIYELWCGEIAGKINVFPLNENGVSG- 2321
            |:.....| |.:...||         ..||.|....|.|:.||.   :|.||:|...:|:..:. 
Human   457 LLLNNANP-NLSNRRGS---------TPLHMAVERRVRGVVELL---LARKISVNAKDEDQWTAL 508

  Fly  2322 HQALCHSEEPN---LIEDVKVARMCSNESHVFSCLYPGCMVYQWDVISKRIENKLDCS-----KL 2378
            |.|..:.:|.:   |:|  |.|.:...:....:.::..|...|.:::...:...:|.|     ..
Human   509 HFAAQNGDESSTRLLLE--KNASVNEVDFEGRTPMHVACQHGQENIVRILLRRGVDVSLQGKDAW 571

  Fly  2379 LPCSESLQSIAIDEHVNLIKCQISALAAH-----NSELYIGTTWGCLIVAELHTLRPISVFRPYE 2438
            ||    |...|...|:.::|    .||..     |::...|.|       .||    ::..|.:.
Human   572 LP----LHYAAWQGHLPIVK----LLAKQPGVSVNAQTLDGRT-------PLH----LAAQRGHY 617

  Fly  2439 NEIKSIITLSKD-NVPLIATIGRRYRSLISR---YVDSAESSTKSSAVSTPTHGAAKSVPPADVD 2499
            ...:.:|.|..| ||          .||:::   :| :||:...|:|......||.|....:|..
Human   618 RVARILIDLCSDVNV----------CSLLAQTPLHV-AAETGHTSTARLLLHRGAGKEAMTSDGY 671

  Fly  2500 NHIH 2503
            ..:|
Human   672 TALH 675

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LrrkNP_001262772.1 Ank_2 111..200 CDD:289560
ANK 146..286 CDD:238125
ANK repeat 146..177 CDD:293786
Ank_4 179..232 CDD:290365
ANK repeat 179..209 CDD:293786
Ank_2 216..389 CDD:289560
ANK 361..477 CDD:238125
ANK repeat 361..390 CDD:293786
Ank_2 364..464 CDD:289560
ANK repeat 406..435 CDD:293786
ANK repeat 437..464 CDD:293786
LRR_8 <544..580 CDD:290566
leucine-rich repeat 547..569 CDD:275380
LRR_8 569..629 CDD:290566
leucine-rich repeat 570..595 CDD:275380
leucine-rich repeat 596..618 CDD:275380
leucine-rich repeat 619..641 CDD:275380
leucine-rich repeat 642..676 CDD:275380
leucine-rich repeat 677..730 CDD:275380
LRR_8 729..788 CDD:290566
leucine-rich repeat 731..754 CDD:275380
LRR_8 855..933 CDD:290566
leucine-rich repeat 855..901 CDD:275380
leucine-rich repeat 902..924 CDD:275380
leucine-rich repeat 925..949 CDD:275380
P-loop_NTPase 993..1211 CDD:304359
COR 1230..1471 CDD:292713
STYKc 1796..2092 CDD:214568 77/314 (25%)
STKc_LRRK 1801..2095 CDD:270902 77/317 (24%)
RIPK4NP_065690.2 STKc_RIP4_like 25..290 CDD:270927 77/317 (24%)
STYKc 26..279 CDD:214568 75/306 (25%)
ANK 413..524 CDD:238125 31/136 (23%)
ANK repeat 437..468 CDD:293786 7/32 (22%)
Ank_2 442..534 CDD:289560 27/107 (25%)
ANK repeat 470..501 CDD:293786 13/42 (31%)
ANK 471..589 CDD:238125 31/139 (22%)
ANK repeat 503..534 CDD:293786 7/32 (22%)
Ank_2 508..600 CDD:289560 20/101 (20%)
ANK repeat 536..567 CDD:293786 4/30 (13%)
ANK repeat 569..600 CDD:293786 9/38 (24%)
ANK 598..723 CDD:238125 23/100 (23%)
ANK repeat 603..634 CDD:293786 10/51 (20%)
Ank_2 608..699 CDD:289560 20/83 (24%)
ANK repeat 636..667 CDD:293786 8/31 (26%)
ANK repeat 669..699 CDD:293786 2/7 (29%)
Ank_2 674..764 CDD:289560 1/2 (50%)
ANK 729..>764 CDD:238125
ANK repeat 734..764 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.