DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lrrk and Map3k11

DIOPT Version :9

Sequence 1:NP_001262772.1 Gene:Lrrk / 42447 FlyBaseID:FBgn0038816 Length:2513 Species:Drosophila melanogaster
Sequence 2:NP_071295.2 Gene:Map3k11 / 26403 MGIID:1346880 Length:850 Species:Mus musculus


Alignment Length:508 Identity:122/508 - (24%)
Similarity:193/508 - (37%) Gaps:150/508 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  1655 PVGCNRPSRSSRRGAGAYFLHGVGDPGEDGALNVFSAYLN----ATARRERRSEDSLGAGSDADS 1715
            |:|       |..|:|:....|.|....:|:....:||.|    |....|...:|.|....    
Mouse    12 PLG-------SWNGSGSGGGGGTGGVRPEGSPKATAAYANPVWTALFDYEPNGQDELALRK---- 65

  Fly  1716 GVGPDSAGSSRNTSVDGHPGYHLPDNSNVCYAWMIEECILSVYNQSKISCPVHLEQSMAQLAPDV 1780
              |......||:.::.|..|:           |                        ..|:...|
Mouse    66 --GDRVEVLSRDAAISGDEGW-----------W------------------------AGQVGGQV 93

  Fly  1781 -IFADIPDKHTIPSECIIKG-----------------SLLGRGAFGFVFKANCKVRGARSFKPVA 1827
             ||         ||..:.:|                 .::|.|.||.|::.:.:           
Mouse    94 GIF---------PSNYVSRGGGPPPCEVASFQELRLEEVIGIGGFGKVYRGSWR----------- 138

  Fly  1828 MKMLQPVPPGARAKESALMAFKVAVGKWDRDPLQHSCKAYCTARQELAVLLTLKHPNIVPLVGIC 1892
                           ..|:|.|.|    .:||.:.......:.|||..:...|.||||:.|..:|
Mouse   139 ---------------GELVAVKAA----RQDPDEDISVTAESVRQEARLFAMLAHPNIIALKAVC 184

  Fly  1893 IKP--LALVLELAPLGGLDALLRHYRRSGAHMGPHTFQTLVLQAARAIEYLHRRR---IIYRDLK 1952
            ::.  |.||:|.|..|.|...|     :|..:.||......:|.||.:.|||...   :|:||||
Mouse   185 LEEPNLCLVMEYAAGGPLSRAL-----AGRRVPPHVLVNWAVQIARGMHYLHCEALVPVIHRDLK 244

  Fly  1953 SENVLVWELPQPHTEDSPRNLVH--IKIADYGISRQTAPSGAKGFGGTEGFMAPEIIRYNGEEEY 2015
            |.|:|   |.||...|   ::.|  :||.|:|::|:...:......||..:||||:|:   ...:
Mouse   245 SNNIL---LLQPIEGD---DMEHKTLKITDFGLAREWHKTTQMSAAGTYAWMAPEVIK---ASTF 300

  Fly  2016 TEKVDCFSFGMFIYENISLRQPFEGHESIKECILEGSRPALTQRETQFPTCC----LDLMVLCWH 2076
            ::..|.:|||:.::|.::...|:.|    .:|:......|:.:.....|:.|    ..||..||.
Mouse   301 SKGSDVWSFGVLLWELLTGEVPYRG----IDCLAVAYGVAVNKLTLPIPSTCPEPFAQLMADCWA 361

  Fly  2077 EQPRRRPTASQIVSILSAPECIHLLDVVAMP----HS-----EKIVCGVFQSL 2120
            :.|.|||..:.|:..|.|.|...|.:   ||    ||     ::.:.|:|..|
Mouse   362 QDPHRRPDFASILQQLEALEAQVLRE---MPRDSFHSMQEGWKREIQGLFDEL 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LrrkNP_001262772.1 Ank_2 111..200 CDD:289560
ANK 146..286 CDD:238125
ANK repeat 146..177 CDD:293786
Ank_4 179..232 CDD:290365
ANK repeat 179..209 CDD:293786
Ank_2 216..389 CDD:289560
ANK 361..477 CDD:238125
ANK repeat 361..390 CDD:293786
Ank_2 364..464 CDD:289560
ANK repeat 406..435 CDD:293786
ANK repeat 437..464 CDD:293786
LRR_8 <544..580 CDD:290566
leucine-rich repeat 547..569 CDD:275380
LRR_8 569..629 CDD:290566
leucine-rich repeat 570..595 CDD:275380
leucine-rich repeat 596..618 CDD:275380
leucine-rich repeat 619..641 CDD:275380
leucine-rich repeat 642..676 CDD:275380
leucine-rich repeat 677..730 CDD:275380
LRR_8 729..788 CDD:290566
leucine-rich repeat 731..754 CDD:275380
LRR_8 855..933 CDD:290566
leucine-rich repeat 855..901 CDD:275380
leucine-rich repeat 902..924 CDD:275380
leucine-rich repeat 925..949 CDD:275380
P-loop_NTPase 993..1211 CDD:304359
COR 1230..1471 CDD:292713
STYKc 1796..2092 CDD:214568 84/323 (26%)
STKc_LRRK 1801..2095 CDD:270902 84/304 (28%)
Map3k11NP_071295.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..35 4/18 (22%)
SH3_MLK1-3 46..103 CDD:212992 16/106 (15%)
STKc_MLK3 114..380 CDD:271049 84/313 (27%)
Leucine-zipper 1 404..425 3/8 (38%)
Leucine-zipper 2 439..460
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 535..644
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 657..850
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.