DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pi3K92E and SH3PXD2A

DIOPT Version :9

Sequence 1:NP_001262770.1 Gene:Pi3K92E / 42446 FlyBaseID:FBgn0015279 Length:1088 Species:Drosophila melanogaster
Sequence 2:NP_001380944.1 Gene:SH3PXD2A / 9644 HGNCID:23664 Length:1133 Species:Homo sapiens


Alignment Length:491 Identity:81/491 - (16%)
Similarity:167/491 - (34%) Gaps:163/491 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   498 NPRKEECALVDLTFLSSGTGTV----------------RYPSE----------------EVVLQY 530
            ||.|....::::|:..|.:.|:                ::|.|                :::.:.
Human    19 NPSKHYVYIINVTWSDSTSQTIYRRYSKFFDLQMQLLDKFPIEGGQKDPKQRIIPFLPGKILFRR 83

  Fly   531 AADRE-QVNRLQRQLAGPEKPIKE----LKELMANYTGLDKIYEMVDQDRNAIWERRNDILRELP 590
            :..|: .|.||        |||.|    |..|..:.:..|:::.        .:|.|       |
Human    84 SHIRDVAVKRL--------KPIDEYCRALVRLPPHISQCDEVFR--------FFEAR-------P 125

  Fly   591 EELSILLHCVYWKERDDVA-----DMWYLLKQWPLISIERSLELLDYAYPDPAVRRFAIRCLHFL 650
            |:::        ..::|..     .:|  |..| ..|.::.:...| |..:|.:....:...::.
Human   126 EDVN--------PPKEDYGSSKRKSVW--LSSW-AESPKKDVTGAD-ATAEPMILEQYVVVSNYK 178

  Fly   651 KDEDLLLYLLQLVQAIKHESYLESDLVVFLLERALRNQRIGHYFFWHLRSEMQTPS--MQTRFGL 713
            |.|:             .|..|::..||.::|:    ...|.:|......:...|:  ::.:.|.
Human   179 KQEN-------------SELSLQAGEVVDVIEK----NESGWWFVSTSEEQGWVPATYLEAQNGT 226

  Fly   714 LLEVYLKGCKHHVAPLRKQLHVLEKLKQ----GSLIAKKGSKEKVKTMLQDFLRDQRNSAVFQNI 774
            ..:..:...|......|::.| |.:|.:    |.::.::.|:|:....:|.:....::...|:  
Human   227 RDDSDINTSKTGEVSKRRKAH-LRRLDRRWTLGGMVNRQHSREEKYVTVQPYTSQSKDEIGFE-- 288

  Fly   775 QNPLNPSFRCSGVTPDRCKVMDSKMRPLWVVFENADVNASDVHIIFKNGDDLRQDMLTLQMLRVM 839
                      .|||   .:|:...:...|.:........:....:.|..|||.            
Human   289 ----------KGVT---VEVIRKNLEGWWYIRYLGKEGWAPASYLKKAKDDLP------------ 328

  Fly   840 DQLWKRDGMDFRMNIYNCISMEKSL-GMIEVVRHAETIANIQKEKGMFSATSPFKKGSLLSWLKE 903
                               :.:|:| |.:|::.:...|:|:..:|......:|..:|      :.
Human   329 -------------------TRKKNLAGPVEIIGNIMEISNLLNKKASGDKETPPAEG------EG 368

  Fly   904 HNKPADKLNKAINEFTLSCAGYCVAT--YVLGVADR 937
            |..|..|     .|.:|..  .|.|:  ..:||.||
Human   369 HEAPIAK-----KEISLPI--LCNASNGSAVGVPDR 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pi3K92ENP_001262770.1 PI3K_p85B 56..132 CDD:295322
PI3K_rbd 200..307 CDD:197540
C2_PI3K_class_I_beta_delta 339..517 CDD:176075 5/18 (28%)
PI3Ka_I 552..723 CDD:238444 27/181 (15%)
PI3Kc_I 727..1084 CDD:270709 38/218 (17%)
SH3PXD2ANP_001380944.1 PX_FISH 6..124 CDD:132798 20/120 (17%)
SH3_Tks5_1 170..222 CDD:213007 10/68 (15%)
SH3_Tks5_2 269..322 CDD:213010 7/67 (10%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 415..446
SH3_Tks5_3 451..504 CDD:213012
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 505..840
SH3_Tks5_4 844..896 CDD:212952
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 899..924
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 941..964
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1029..1059
SH3_Tks5_5 1076..1132 CDD:212953
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.