DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pi3K92E and SH3PXD2B

DIOPT Version :9

Sequence 1:NP_001262770.1 Gene:Pi3K92E / 42446 FlyBaseID:FBgn0015279 Length:1088 Species:Drosophila melanogaster
Sequence 2:XP_016864840.1 Gene:SH3PXD2B / 285590 HGNCID:29242 Length:939 Species:Homo sapiens


Alignment Length:456 Identity:77/456 - (16%)
Similarity:134/456 - (29%) Gaps:206/456 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   321 VTKRPLPKKRTVHLHKSISSLWDMGNYFQLTLHSISNVNFDKTRALKVGVHVCLYHGDKKLCAQR 385
            |.||.:|.|..|::   |...|..|                                        
Human    15 VQKRRVPNKHYVYI---IRVTWSSG---------------------------------------- 36

  Fly   386 STDSPNGNFDTFLFNDLVMDFDIQMRNLPRMTRLCIVIFEVTKMSRSKKSSNNKDIALKDVPYNK 450
            ||::....:..|        ||:||:.|.:.                ......||...:.:|:..
Human    37 STEAIYRRYSKF--------FDLQMQMLDKF----------------PMEGGQKDPKQRIIPFLP 77

  Fly   451 NPLAWVNTTIFDHKDILRTGRHTLYTWTYADDIQSVEVFHPLGTIEPNPRKEEC-ALVDLTFLSS 514
            ..:                    |:..::..|:....:.         |..|.| ||:.|.    
Human    78 GKI--------------------LFRRSHIRDVAVKRLI---------PIDEYCKALIQLP---- 109

  Fly   515 GTGTVRYPSE-EVVLQYAADR-EQVNRLQRQLAGPEKP----------IKELKELMANY------ 561
                 .|.|: :.|||:...| |.:|..:.:..|.:|.          :.|...::|||      
Human   110 -----PYISQCDEVLQFFETRPEDLNPPKEEHIGKKKSGGDQTSVDPMVLEQYVVVANYQKQESS 169

  Fly   562 ---TGLDKIYEMVDQDRNAIW----------------ERRNDILREL---PEELSILLHCVYWK- 603
               ..:.::.::::::.:..|                |.::.:..|.   |||:|    ..||. 
Human   170 EISLSVGQVVDIIEKNESGWWFVSTAEEQGWVPATCLEGQDGVQDEFSLQPEEVS----WRYWSL 230

  Fly   604 -----ERDDVADMWYLLKQWPLISIERSLELLDYAYPDPAVRRFAIRCLHFLKDEDLLLYLLQLV 663
                 .|..:.|::.:  .|      |..|.....||..|            :|:|         
Human   231 PRPVGRRRTLGDLYAI--SW------RQEEKYTVIYPYTA------------RDQD--------- 266

  Fly   664 QAIKHESYLESDLVVFLLERALRNQRIGHYFFWHLRSEMQTPSMQTRFGLLLEVYLKGCKHHVAP 728
                 |..||...||.::::.|..       :|.:|       .|.:.|.....|||  |:...|
Human   267 -----EMNLERGAVVEVIQKNLEG-------WWKIR-------YQGKEGWAPASYLK--KNSGEP 310

  Fly   729 L 729
            |
Human   311 L 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pi3K92ENP_001262770.1 PI3K_p85B 56..132 CDD:295322
PI3K_rbd 200..307 CDD:197540
C2_PI3K_class_I_beta_delta 339..517 CDD:176075 21/178 (12%)
PI3Ka_I 552..723 CDD:238444 36/204 (18%)
PI3Kc_I 727..1084 CDD:270709 2/3 (67%)
SH3PXD2BXP_016864840.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.