DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pi3K92E and Sh3pxd2b

DIOPT Version :9

Sequence 1:NP_001262770.1 Gene:Pi3K92E / 42446 FlyBaseID:FBgn0015279 Length:1088 Species:Drosophila melanogaster
Sequence 2:XP_006514775.1 Gene:Sh3pxd2b / 268396 MGIID:2442062 Length:936 Species:Mus musculus


Alignment Length:216 Identity:43/216 - (19%)
Similarity:82/216 - (37%) Gaps:54/216 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   546 GPEKPIKELKELMANYTGLDKIYEMVDQDRNAIWERRNDILRELPEELSILLHCVYWKERDDVAD 610
            |.|.|.|...:|.|: ||.::|.:...:::.::..|:..|::...|.|.        :||..:..
Mouse   519 GKEAPRKASSDLSAS-TGYEEISDPTQEEKPSLPPRKESIIKSEEELLE--------RERQKMEP 574

  Fly   611 M--------WYLLKQWPLISIERSLELLDYAYPDPAV--RRFAIR------CLHFLKDEDLLLYL 659
            :        ..:|   |:|..:.:....|...|:|.:  .:|.:|      |.|.:..:::....
Mouse   575 LRGSSPKPPGMIL---PMIPAKHAPLARDSRKPEPKLDKSKFPLRNDMGLECGHKVLAKEVKKPN 636

  Fly   660 LQLVQAIKHESYLESDLV------VFLLERALRN------------QRIGHYFFWHLRSEMQTPS 706
            |:.:...|.|  |..:.|      :|:..|....            |...|...::|||:::...
Mouse   637 LRPISRSKAE--LSEEKVDPTSQNLFMKSRPQVRPKPTPSPKTEPAQSEDHVDIYNLRSKLRPAK 699

  Fly   707 MQTRFGLLLEVYLKGCKHHVA 727
            .|.:      ..|.|..||.|
Mouse   700 SQEK------ALLDGESHHAA 714

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pi3K92ENP_001262770.1 PI3K_p85B 56..132 CDD:295322
PI3K_rbd 200..307 CDD:197540
C2_PI3K_class_I_beta_delta 339..517 CDD:176075
PI3Ka_I 552..723 CDD:238444 37/204 (18%)
PI3Kc_I 727..1084 CDD:270709 1/1 (100%)
Sh3pxd2bXP_006514775.1 PX_FISH 7..125 CDD:132798
SH3_Tks4_1 155..209 CDD:213008
SH3_Tks4_2 252..305 CDD:213009
SH3_Tks4_3 400..452 CDD:213011
SH3_Tks4_4 879..934 CDD:212951
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.