DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pi3K92E and Sh3pxd2a

DIOPT Version :9

Sequence 1:NP_001262770.1 Gene:Pi3K92E / 42446 FlyBaseID:FBgn0015279 Length:1088 Species:Drosophila melanogaster
Sequence 2:NP_032044.2 Gene:Sh3pxd2a / 14218 MGIID:1298393 Length:1124 Species:Mus musculus


Alignment Length:241 Identity:45/241 - (18%)
Similarity:80/241 - (33%) Gaps:75/241 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 QAKQMPLGYVIKEACEYQVYGISTFNIEPYTDETKRLSEVQPYFGILSLGERTDTTSFSSDYELT 141
            :|::.|:|     |||.|...:.....||..|        .|.||            |.|:.|:.
Mouse   532 EAEENPVG-----ACESQGSPLKVKYEEPEYD--------VPAFG------------FDSEPEMN 571

  Fly   142 KMVNGMIGTTFDH----NRTHGSPEIDDFRLYMTQTCDNIELERSAYTWQQRLLYEH-------- 194
            :..:|..|:...|    .|...:..:......:.::.:::.||       :..:||:        
Mouse   572 EEPSGDRGSGDKHPAQPRRISPASSLQRAHFKVGESSEDVALE-------EETIYENEGFRPYTE 629

  Fly   195 --------------------PLRLANSTKMPELIRERHPTRTFLIVVKNENDQSTFTLSVNEQDT 239
                                .|.:.||.|...      |..:.|:.:|.|.:... .|..|:.:.
Mouse   630 DTLSARGSSGDSDSPGSSSLSLAVKNSPKSDS------PKSSSLLKLKAEKNAQA-ELGKNQSNI 687

  Fly   240 PF--SLTESTLQKMNRSQMKMNDRTSDYILKVSGRDEYLLGDYPLI 283
            .|  |:|.||....:.|...::....|  ||.....:..:.|.|.:
Mouse   688 SFSSSVTISTTCSSSSSSSSLSKNNGD--LKPRSASDAGIRDTPKV 731

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pi3K92ENP_001262770.1 PI3K_p85B 56..132 CDD:295322 13/54 (24%)
PI3K_rbd 200..307 CDD:197540 20/86 (23%)
C2_PI3K_class_I_beta_delta 339..517 CDD:176075
PI3Ka_I 552..723 CDD:238444
PI3Kc_I 727..1084 CDD:270709
Sh3pxd2aNP_032044.2 PX_FISH 6..124 CDD:132798
SH3_Tks5_1 170..222 CDD:213007
SH3_Tks5_2 269..322 CDD:213010
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 414..443
SH3_Tks5_3 450..503 CDD:213012
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 504..672 30/177 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 692..830 10/42 (24%)
SH3_Tks5_4 838..888 CDD:212952
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 886..952
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1020..1050
SH3_Tks5_5 1067..1123 CDD:212953
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.