DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pi3K92E and BOLA2-SMG1P6

DIOPT Version :9

Sequence 1:NP_001262770.1 Gene:Pi3K92E / 42446 FlyBaseID:FBgn0015279 Length:1088 Species:Drosophila melanogaster
Sequence 2:NP_001307551.1 Gene:BOLA2-SMG1P6 / 107282092 HGNCID:53563 Length:305 Species:Homo sapiens


Alignment Length:157 Identity:35/157 - (22%)
Similarity:58/157 - (36%) Gaps:50/157 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   916 NEFTLSCAGYCVATYVLGVADR----HSDNIMVKRNGQL---------FHIDFGHIL-------- 959
            :|..|:.|..||.. :||..|.    |.|.::.....||         :.|...::|        
Human   125 SEAVLTAANECVGV-LLGSLDPSMTIHCDMVITYGLDQLENCQTCGTDYIISVLNLLTLIVEQIN 188

  Fly   960 ----GHFKEKLGVRRERVPFVLTHDFVYVINKGFNDRESKEFCH--FQEL--------CERAF-L 1009
                ..|.|||.:...::.|:..|          .::|.....|  :|.:        .|.|: |
Human   189 TKLPSSFVEKLFIPSSKLLFLRYH----------KEKEVVAVAHAVYQAMLSLKNIPVLETAYKL 243

  Fly  1010 VLRKHGCLILSLFSMMISTGLPELSSE 1036
            :|.:..|   :|.:::.|..|||..||
Human   244 ILGEMTC---ALNNLLHSLQLPEACSE 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pi3K92ENP_001262770.1 PI3K_p85B 56..132 CDD:295322
PI3K_rbd 200..307 CDD:197540
C2_PI3K_class_I_beta_delta 339..517 CDD:176075
PI3Ka_I 552..723 CDD:238444
PI3Kc_I 727..1084 CDD:270709 35/157 (22%)
BOLA2-SMG1P6NP_001307551.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.