DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5466 and LOC11175998

DIOPT Version :10

Sequence 1:NP_650901.2 Gene:CG5466 / 42444 FlyBaseID:FBgn0038815 Length:594 Species:Drosophila melanogaster
Sequence 2:XP_003436971.2 Gene:LOC11175998 / 11175998 VectorBaseID:AGAMI1_006357 Length:624 Species:Anopheles gambiae


Alignment Length:96 Identity:24/96 - (25%)
Similarity:36/96 - (37%) Gaps:24/96 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  1421 VKSMTAHYYMLLFLVDVYETLF---------GLKPSPSFFEWDLFGLLNTCLFTTRSVLYSFVRT 1476
            :...||.....|||....:||.         ||......|||:|...:::...||  .:|     
Mosquito    58 MSKQTAALNKQLFLTLTLQTLLPFILMYGPVGLIFFAPLFEWNLQLFVSSAGATT--AIY----- 115

  Fly  1477 ERMPKGDTLDHSIVQAIFVVNMLRTIITSVT 1507
               |..:.|   ||  ||.:::.|..:...|
Mosquito   116 ---PAFEPL---IV--IFCISLFRNAVFPCT 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5466NP_650901.2 DUF3736 100..221 CDD:463624
LOC11175998XP_003436971.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.