DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Pus1 and AT1G20290

DIOPT Version :9

Sequence 1:	NP_001163664.1	Gene:	Pus1 / 42440	FlyBaseID:	FBgn0038811	Length:	442	Species:	Drosophila melanogaster
Sequence 2:	NP_173454.2	Gene:	AT1G20290 / 838617	AraportID:	AT1G20290	Length:	382	Species:	Arabidopsis thaliana

Alignment Length:	69	Identity:	14/69 - (20%)
Similarity:	33/69 - (47%)	Gaps:	12/69 - (17%)

- Green bases have known domain annotations that are detailed below.

  Fly   366 KDGIHNP-----LTWQA------QEAQVQEFIEREIFSQIYKTEAEQRNMLDWIGTLHYHSY-DT 418
            |:.:.:|     ::|:.      ||.:..:|..:.::|.|...|.:...:..|:.:|:..:| |.
plant    69 KEPLFDPETSARISWREVSVDDDQEQEHDQFKWKHVYSHIGSAEEKDGAVAIWLHSLNQRNYPDL 133

  Fly   419 RTED 422
            |:.:
plant   134 RSNE 137

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID
Pus1	NP_001163664.1	TruA	102..362	CDD:223179
Pus1	NP_001163664.1	PseudoU_synth_PUS1_PUS2	106..357	CDD:211335
AT1G20290	NP_173454.2	None
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0101
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D710785at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.910