DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pus1 and pusl1

DIOPT Version :9

Sequence 1:NP_001163664.1 Gene:Pus1 / 42440 FlyBaseID:FBgn0038811 Length:442 Species:Drosophila melanogaster
Sequence 2:XP_683563.5 Gene:pusl1 / 555828 ZFINID:ZDB-GENE-101110-1 Length:291 Species:Danio rerio


Alignment Length:294 Identity:78/294 - (26%)
Similarity:118/294 - (40%) Gaps:67/294 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 ILLSYCGANYYGMQRNPGMQTIE---EELFKAMLKHKWITEDSFEQIQISCFQRAARTDKGVSA- 166
            |...|.|:.|.|:.:.|..|.::   ..|..|:.|.|.:.|        .|...::|||.||.| 
Zfish    10 IFFQYTGSKYSGVMKAPAHQAVQGVGNHLENAVRKLKPVNE--------VCVSISSRTDTGVHAL 66

  Fly   167 --------ARQVCSVKLPEELDLEAFNADLPQQ-IRLFGVERVTKGFNAKDQCNARTYTYTLPT- 221
                    .|:.....|.|:..|||.|..|.:: ||:....||...|:|:.|..:|||.|.|.. 
Zfish    67 CNSAHVDIQRRADKPPLSEQSLLEALNFQLKEEPIRITRAYRVHSDFHARYQAQSRTYVYRLALG 131

  Fly   222 ---VAFAPFEEKVDDVHDTFRISPELLQKVKETLKLYEGTKNFHNFTSKKSFLDPSSKRFIMSFT 283
               ....|..||  |:....|.:...:..::|...|..||.:|..|               .:.:
Zfish   132 CQHHTLMPLTEK--DLCWALRDTRLNIDAMREASALLLGTHDFSTF---------------RALS 179

  Fly   284 SSEPFRSP---------------------QDIEFVTLKVKGQSFMLHQIRKMVGLAIAIVRGNTT 327
            |..||:.|                     :||:|..|..|.:||:..|:|:|.|:.:||.:|..:
Zfish   180 SDAPFKCPVKTLDLAQLEPGESFSQRHFQRDIQFWELTFKSRSFLYRQVRRMTGVLVAIGQGRLS 244

  Fly   328 AATLERAL-TEERLDLP---MAPGLGLVLDTVHY 357
            .:.::..| ..:.|..|   .||..||.|..|.|
Zfish   245 VSKIQDLLEARDSLAFPNNLTAPAHGLFLTNVQY 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pus1NP_001163664.1 TruA 102..362 CDD:223179 78/294 (27%)
PseudoU_synth_PUS1_PUS2 106..357 CDD:211335 77/292 (26%)
pusl1XP_683563.5 truA 7..278 CDD:234577 77/292 (26%)
PseudoU_synth_EcTruA 10..278 CDD:211337 77/292 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.