DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pus1 and CG34140

DIOPT Version :9

Sequence 1:NP_001163664.1 Gene:Pus1 / 42440 FlyBaseID:FBgn0038811 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_001036574.1 Gene:CG34140 / 4379908 FlyBaseID:FBgn0083976 Length:306 Species:Drosophila melanogaster


Alignment Length:330 Identity:73/330 - (22%)
Similarity:118/330 - (35%) Gaps:116/330 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 LSYCGANYYGMQRNPGMQTIEEELFKAMLKHKWITEDSFEQIQI------SCFQRA--------- 157
            :||.|..:.|:|:                     |.:..||.::      .|.:.|         
  Fly     8 ISYIGTTFRGIQK---------------------TVNKLEQSRLDTKSIQGCLELALQVFHPTNE 51

  Fly   158 ------ARTDKGVSAARQVCSVKLPEELDLE--------------AFNADLPQQ---IRLFGVER 199
                  :|||.||.|......|      |||              ..|..|.:|   ||:...:.
  Fly    52 IHTVLSSRTDAGVHALHSTVQV------DLERPNGQPYDTTILTGVLNRTLNKQRLPIRVLSSKL 110

  Fly   200 VTKGFNAKDQCNARTYTY-----TLPTV-----------AFAPFEEKVDDVHDTFRISPEL-LQK 247
            |...|:.:.....|||.|     .:||:           .|.|.|| :|..:  |..|... :::
  Fly   111 VANSFHCRYDAIGRTYLYRFAVAKVPTLGDCSLRNRSFETFIPVEE-IDRCY--FLQSSSFDIKR 172

  Fly   248 VKETLKLYEGTKNFHNFTS---KKSFLD---------------PSSKRFIMSFTSSEPFRSPQDI 294
            |:...:::.|..:|..|.|   :|...|               |...|.:    ||...::.:..
  Fly   173 VQAAARMFIGVHDFRTFMSVSRQKVCRDHPMFTVRKIDEINIRPGETRAL----SSNAIQAAETY 233

  Fly   295 EFVTLKVKGQSFMLHQIRKMVGLAIAIVRGNTTAATLERALT-------EERLDLPMAPGLGLVL 352
            .:..::::.:||:..|:|::||..||:..|......|.:.||       :.|:.|  ||..||.|
  Fly   234 NYWDIEIRAKSFLYKQVRRIVGALIALGNGRIDERCLYQMLTVPSKNSWDHRVLL--APACGLYL 296

  Fly   353 DTVHY 357
            ..|||
  Fly   297 CRVHY 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pus1NP_001163664.1 TruA 102..362 CDD:223179 73/330 (22%)
PseudoU_synth_PUS1_PUS2 106..357 CDD:211335 71/328 (22%)
CG34140NP_001036574.1 truA 1..301 CDD:234577 71/328 (22%)
PseudoU_synth_EcTruA 6..301 CDD:211337 71/328 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450170
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0101
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11142
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.