DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pus1 and Pusl1

DIOPT Version :9

Sequence 1:NP_001163664.1 Gene:Pus1 / 42440 FlyBaseID:FBgn0038811 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_001382537.1 Gene:Pusl1 / 362681 RGDID:1559560 Length:291 Species:Rattus norvegicus


Alignment Length:289 Identity:72/289 - (24%)
Similarity:122/289 - (42%) Gaps:41/289 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 RKKSAILLSYCGANYYGM------QRNPGMQTIEEELFKAMLKHKWITEDSFEQIQISCFQRAAR 159
            |.:..:...|.|.::.|:      .|..|:|...||..|.:        :|.|.::   |..::|
  Rat    11 RARYLVFFQYLGTDFNGVAAVRGNHRAVGVQNFLEEAAKRL--------NSVEPVR---FTISSR 64

  Fly   160 TDKGVSAARQVCSVKLPE---------ELDLEAFNADLPQ-QIRLFGVERVTKGFNAKDQCNART 214
            ||.||.|......:.:..         |:..:|.|..|.. .||:....||...|:|:....:||
  Rat    65 TDAGVHALSNAAHLDIQRRPGRPPFSPEIVTKALNTHLKHPAIRVLKAFRVPNDFHARHAATSRT 129

  Fly   215 YTYTLPTVAFAPFEEKVDDVHDTFRISPELLQ--KVKETLKLYEGTKNFHNFTSKKSFLDPSSKR 277
            |.|.|.|....|.:..|.:.:..:.:..|.|.  .::|..:...||.:|..|.|..|.:..:.:.
  Rat   130 YLYRLATGCSGPNQLPVFEQNVCWSLQTEYLDIAAMQEAAQHLLGTHDFSAFQSAGSPVPHAVRT 194

  Fly   278 FIMSFTSSEP---FRSPQD---IEFVTLKVKGQSFMLHQIRKMVGLAIAIVRGNTTAATLERALT 336
            ......|..|   |..||:   ::|.||:.:.|||:..|:|:|..:.:|:..| ..|.|..:.:.
  Rat   195 LRRVSVSPGPASLFVLPQESRRLQFWTLEFESQSFLYRQVRRMTAVLVAVGLG-ILAPTQVKVIL 258

  Fly   337 EE-----RLDLPMAPGLGLVLDTVHYERY 360
            |.     :....:||..||.|.:|.|:.:
  Rat   259 ESQDPLGKYQARVAPAHGLFLKSVLYDNF 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pus1NP_001163664.1 TruA 102..362 CDD:223179 71/288 (25%)
PseudoU_synth_PUS1_PUS2 106..357 CDD:211335 70/279 (25%)
Pusl1NP_001382537.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.