DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pus1 and Y73B6BL.29

DIOPT Version :9

Sequence 1:NP_001163664.1 Gene:Pus1 / 42440 FlyBaseID:FBgn0038811 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_500962.1 Gene:Y73B6BL.29 / 260252 WormBaseID:WBGene00022250 Length:322 Species:Caenorhabditis elegans


Alignment Length:281 Identity:67/281 - (23%)
Similarity:117/281 - (41%) Gaps:59/281 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 QTIEEELFKAMLKHKWITEDSFEQIQISCFQRAARTDKGVSAARQ--VCSVKLP-EELD-----L 181
            |||...:|.:..:.   |.:..::::   |..::|||..|.|.|.  :|.|.|. .|||     .
 Worm    36 QTISTSIFGSRCEQ---TPNCSDRLK---FSPSSRTDAKVHAIRNSVICQVPLEYAELDKTPETK 94

  Fly   182 EAF------NADL--PQQIRLFGVERVTKGFNAKDQCNARTYTYTL---------------PTVA 223
            :||      ..|:  |..:.:..|..|:.||..:...:.|.|||.:               |:::
 Worm    95 KAFMTSWKNTIDVANPGSLEIHDVHSVSAGFCIRRSVSYRKYTYRMAVCRSWELWESIRQEPSIS 159

  Fly   224 FAPFEEKVDDVHDTFRISPEL-LQKVKETLKLYEGTK---NFHNFTSKKSFLDPSSKR-----FI 279
            .  |.|:    ...:|:.|.. ..||.:..||:||.:   :|...|:::...:|.|..     |.
 Worm   160 C--FSER----DYAWRLPPGFSAHKVLQAGKLFEGEQVMGSFFKHTAREKRYEPISPTALKYIFH 218

  Fly   280 MSFTSSEPFRSPQDI-EFVTLKVKGQSFMLHQIRKMVGLAIAIVRGNTTAATLERALTEE----- 338
            :..:..|.:....|| ::..:.:..:||:..|||:|:...:..........|:|..|:..     
 Worm   219 VGLSKGEAYSMENDIYDYYNVTIVAKSFVREQIRRMMSCLVNYSYDRIPLTTIEWLLSNPISSNF 283

  Fly   339 -RLDLPMAPGLGLVLDTVHYE 358
             .|.:|:||..||.|..|.|:
 Worm   284 FDLGIPVAPPQGLFLTDVVYD 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pus1NP_001163664.1 TruA 102..362 CDD:223179 67/281 (24%)
PseudoU_synth_PUS1_PUS2 106..357 CDD:211335 66/278 (24%)
Y73B6BL.29NP_500962.1 TruA 5..315 CDD:223179 67/281 (24%)
PseudoU_synth 62..303 CDD:294089 60/246 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.