DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pus1 and SPCC16C4.06c

DIOPT Version :9

Sequence 1:NP_001163664.1 Gene:Pus1 / 42440 FlyBaseID:FBgn0038811 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_001342755.1 Gene:SPCC16C4.06c / 2539359 PomBaseID:SPCC16C4.06c Length:413 Species:Schizosaccharomyces pombe


Alignment Length:352 Identity:98/352 - (27%)
Similarity:162/352 - (46%) Gaps:55/352 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 IKRKKSAI--LLSYCGANYYGMQRNPGMQTIEEELFKAMLKHKWITE---DSFEQIQISCFQRAA 158
            :|.:|..:  ::||.|..:.|:|.|..::||::.||:|..:...:.:   ||.::|:: |  .||
pombe    32 VKPRKRMVYCVVSYRGTGFAGLQYNANVKTIQDTLFQAFARVGAVVQVNADSPKKIRM-C--SAA 93

  Fly   159 RTDKGVSAARQVCSVK------LPEELDLEAFNADLPQQIRLFGVERVTKGFNAKDQCNARTYTY 217
            ||||||.|...|..:|      ||..::|  .|..||..||::.:.|....|:....|::|.|.|
pombe    94 RTDKGVHAIVNVLGLKVLDNQPLPHVVNL--VNDILPPCIRVWKMARTFNSFSPHTVCDSRVYEY 156

  Fly   218 TLP-------------TVAFAPFEEKVDDVHDT--------------------FRISPELLQKVK 249
            .||             ....|...||...:::|                    ||:|...|..:|
pombe   157 WLPVSSLLTPRPCTLEAYVIAKASEKAFPINETLSHLANLSKQDCVANSLSEPFRLSKPKLDFLK 221

  Fly   250 ETLKLYEGTKNFHNFTSKKSFLDPSSKRFIMSFTSSEPFRSPQDIEFVTLKVKGQSFMLHQIRKM 314
            ....::.||..||::|::|.|.|.||:||::............:.::|.|...|||||.||||||
pombe   222 HACTMFRGTHRFHSYTTEKGFSDASSRRFLLDVRVDNLHIDKLNRQWVKLIFHGQSFMKHQIRKM 286

  Fly   315 VGLAIAIVRGNTTAATLERALTEE-RLDLPMAPGLGLVLDTVHYERYNDRYGKDGIHNPLTWQAQ 378
            ||:.|.:.|....|..|....... |:.:|.||...|:|:...::.:|.:..:.. |.|:.|...
pombe   287 VGILIHLTRTGWNAQVLLNTFNNSYRIRIPRAPAEFLLLNQPIFQAFNKKCSRFD-HEPVEWSCA 350

  Fly   379 EAQVQE----FIEREIFSQIYKTEAEQ 401
            :..:.:    |:...:|.....:|:.|
pombe   351 QKGIDQFAHSFLRTPMFDCFISSESFQ 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pus1NP_001163664.1 TruA 102..362 CDD:223179 89/304 (29%)
PseudoU_synth_PUS1_PUS2 106..357 CDD:211335 88/295 (30%)
SPCC16C4.06cNP_001342755.1 PseudoU_synth_PUS1_PUS2 41..330 CDD:211335 88/293 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54496
OrthoFinder 1 1.000 - - FOG0002248
OrthoInspector 1 1.000 - - otm47418
orthoMCL 1 0.900 - - OOG6_101974
Panther 1 1.100 - - O PTHR11142
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1684
TreeFam 1 0.960 - -
98.780

Return to query results.
Submit another query.