DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sep2 and pnut

DIOPT Version :9

Sequence 1:NP_524417.1 Gene:Sep2 / 42438 FlyBaseID:FBgn0014029 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_477064.1 Gene:pnut / 35801 FlyBaseID:FBgn0013726 Length:539 Species:Drosophila melanogaster


Alignment Length:418 Identity:165/418 - (39%)
Similarity:261/418 - (62%) Gaps:24/418 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VHLRTLKQSGHVGFDSLPDQLVNKSVQNGFVFNVMCIGETGLGKSTLMDTLF-----NTSFESTP 72
            |..:.::.:|:|||.:||:|:..|:|:.||.|.:|.:|.:|||||||::::|     |......|
  Fly   112 VRQKPMEIAGYVGFANLPNQVYRKAVKRGFEFTLMVVGASGLGKSTLINSMFLSDIYNAEQYPGP 176

  Fly    73 SPHTLPSVKLKAHTYELQESNVRLKLTICDTVGYGDQINKDDSFKAVVDYIDAQFENYLQEELKI 137
            |.....:|.::|....|:|:.|.|.||:.||.|:||.::..:.:..:::|:|:::|.||..|.::
  Fly   177 SLRKKKTVAVEATKVMLKENGVNLTLTVVDTPGFGDAVDNSNCWVPILEYVDSKYEEYLTAESRV 241

  Fly   138 KRSLVTCHDSRIHICLYFICPTGHGLKSLDLVCMKKLDSKVNIIPVIAKADTISKVELQRFKAKI 202
            .|.  |..|||:|.|||||.|:||||..||:.||:.|..|||::||||||||::..|:..||.:|
  Fly   242 YRK--TISDSRVHCCLYFIAPSGHGLLPLDIACMQSLSDKVNLVPVIAKADTMTPDEVHLFKKQI 304

  Fly   203 IQELNANGVHIYQFPTDDETVAE---TNTSMNSHIPFAVVGSTEFIKVGNKLIRARQYPWGTVQV 264
            :.|:..:.:.||.||...|..||   |..::.|.:||||||:...|:...|.:|.|:||||.|:|
  Fly   305 LNEIAQHKIKIYDFPATLEDAAEEAKTTQNLRSRVPFAVVGANTIIEQDGKKVRGRRYPWGLVEV 369

  Fly   265 ENETHCDFVKLREMLIRTNMEDMREKTHTRHYELYRQKRLEQMGFSDVD---SDNKPISFQQTFE 326
            ||.|||||:.||.|:|||:::|:::.|:..|||.||.::|.::|..|..   |:..|::  |..|
  Fly   370 ENLTHCDFIALRNMVIRTHLQDLKDVTNNVHYENYRCRKLSELGLVDGKARLSNKNPLT--QMEE 432

  Fly   327 AKRSNHLAELQSKEEEVRQMFVQRVKEKEAELKESEKDLHAKFEKLKRDHAEEKRKLEESRKALE 391
            .|| .|..:::..|.|:.|:|..:||||..:|::||.:       |.|.|.|.|:.||...:.||
  Fly   433 EKR-EHEQKMKKMEAEMEQVFDMKVKEKMQKLRDSELE-------LARRHEERKKALELQIRELE 489

  Fly   392 EDYLDFQRRKQQLATAHHTLTLGKSKKK 419
            |...:|:|.|::....:| :||.:.|::
  Fly   490 EKRREFEREKKEWEDVNH-VTLEELKRR 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sep2NP_524417.1 CDC_Septin 40..308 CDD:206649 118/275 (43%)
PTZ00121 <285..393 CDD:173412 37/110 (34%)
pnutNP_477064.1 CDC3 121..482 CDD:227352 152/372 (41%)
Septin 139..411 CDD:279124 118/273 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452040
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5019
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D107010at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18884
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2060
SonicParanoid 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.