DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16953 and Tmem130

DIOPT Version :9

Sequence 1:NP_650897.3 Gene:CG16953 / 42437 FlyBaseID:FBgn0038809 Length:573 Species:Drosophila melanogaster
Sequence 2:NP_001163870.1 Gene:Tmem130 / 304280 RGDID:1563248 Length:424 Species:Rattus norvegicus


Alignment Length:343 Identity:67/343 - (19%)
Similarity:103/343 - (30%) Gaps:112/343 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 TSTTPATTTTPKTTTSSTSTTTTTTPKPPARSKRDLIQAMHANAALLG---LNLTSALNQQKSSA 307
            |:..|||..|..|.::|.......:...||.:.......:|....|..   .||||.:....|..
  Rat    38 TTDGPATMGTEVTISASLVVKDNGSLPLPADAHLYRFHWIHTPLTLTAKTEKNLTSTIRVVGSVP 102

  Fly   308 GN--VSV----------------ALVNPLGVRRVSKLTLV--PGLQPPFDCVSKK-----FVAQD 347
            |:  |||                |||.|:....|..|.:.  ..|..|...::|:     |:..|
  Rat   103 GDFPVSVWVTAVDCWMCKPLARSALVLPIKESLVGNLVVTQNTSLSWPNSYITKRSLRLSFLLHD 167

  Fly   348 PKQIYG-----------------------YYQH----------RVVS------------------ 361
            |...:.                       ||.:          |||:                  
  Rat   168 PSDFFKSASFFYRWDFGDGTMLITDNSVVYYNYSSPGTFTVKVRVVAEWEQTKLDTTKGIIQKTG 232

  Fly   362 --------KDPITGFGTTGKNWLQHWEVLKLNVNCKGSPPFELCTRVFTAPYNSTGNETCDQYEP 418
                    ::.:.|....|...:|.::.|.:.:|..||||..:|..:         ...|...|.
  Rat   233 DFSTSLRLRETLQGIQILGPTLMQTFQKLTMTMNFLGSPPLHVCWGL---------KPQCLALED 288

  Fly   419 IETC--------SYEYMRYFSESKTILFFIR--NEVSQTLNQVTINMYEAQRQSQLSVVVVPVSC 473
            .| |        |:.....|.:.....|..|  |.:|:......|.::    .|.....|....|
  Rat   289 RE-CHPVLVTRTSFNLTHVFQDPGDYCFIFRAENAISKAHQYHRIQVW----PSSFQPFVFAFPC 348

  Fly   474 TLVAVILVVFGVAYYIQR 491
            ..:..:|:|| |.|...|
  Rat   349 ATLITVLLVF-VMYMTVR 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16953NP_650897.3 None
Tmem130NP_001163870.1 PKD <179..212 CDD:279180 2/32 (6%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D381727at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.