DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srp14 and SRP14

DIOPT Version :9

Sequence 1:NP_650896.2 Gene:Srp14 / 42436 FlyBaseID:FBgn0038808 Length:109 Species:Drosophila melanogaster
Sequence 2:NP_010191.1 Gene:SRP14 / 851466 SGDID:S000002250 Length:146 Species:Saccharomyces cerevisiae


Alignment Length:115 Identity:31/115 - (26%)
Similarity:41/115 - (35%) Gaps:28/115 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 EKIANAAKKDSSFTLTFKRYDGNDKPVPREGRPPLPK---PE------------------TYMCL 57
            |....|.:|..:..||.||...:|   |.||......   |:                  .|..|
Yeast    18 EFFQTANEKHITVRLTAKRLIEHD---PVEGNLEFDSTNHPDYDVSKKASEISVSSRSDREYPLL 79

  Fly    58 MR----AQSKSQKISTVVRQEDVPAMMSMYSQFMKSKMDGLKRVKKVKSK 103
            :|    :..|..|.||||:..::......||...|..|..|.:.||.|||
Yeast    80 IRMSYGSHDKKTKCSTVVKASELDQFWQEYSSVFKGGMQNLIKKKKKKSK 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Srp14NP_650896.2 SRP14 4..94 CDD:280455 25/104 (24%)
SRP14NP_010191.1 SRP14 7..120 CDD:396738 25/104 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1761
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103910
Panther 1 1.100 - - LDO PTHR12013
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.