DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srp14 and AT2G43640

DIOPT Version :9

Sequence 1:NP_650896.2 Gene:Srp14 / 42436 FlyBaseID:FBgn0038808 Length:109 Species:Drosophila melanogaster
Sequence 2:NP_001078050.1 Gene:AT2G43640 / 818966 AraportID:AT2G43640 Length:121 Species:Arabidopsis thaliana


Alignment Length:108 Identity:30/108 - (27%)
Similarity:52/108 - (48%) Gaps:2/108 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVLLDNSNFILRLEKIANAAKKDSSFTLTFKRYDGNDKPVPREGRPPLPKPETYMCLMRAQSKSQ 65
            ||||....|:..|..:...:|:..|..:|.||.....| |.:.....:.:...|.||:||....:
plant     1 MVLLQLDPFLNELTSMFEKSKEKGSVWVTLKRSSLKSK-VQKRKLSSVGESIEYRCLIRATDGKK 64

  Fly    66 KISTVVRQEDVPAMMSMYSQFMKSKMDGLKRVKKVKSKAKATK 108
            .:||.|..:|.....:.|:..:|:.|..||: ::.|.:.|:|:
plant    65 TVSTSVGAKDHQRFQASYATILKAHMTALKK-RERKDRKKSTE 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Srp14NP_650896.2 SRP14 4..94 CDD:280455 22/89 (25%)
AT2G43640NP_001078050.1 SRP14 4..93 CDD:396738 22/89 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1761
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55799
OrthoDB 1 1.010 - - D1634105at2759
OrthoFinder 1 1.000 - - FOG0005825
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103910
Panther 1 1.100 - - LDO PTHR12013
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.880

Return to query results.
Submit another query.