DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srp14 and SRP14

DIOPT Version :9

Sequence 1:NP_650896.2 Gene:Srp14 / 42436 FlyBaseID:FBgn0038808 Length:109 Species:Drosophila melanogaster
Sequence 2:NP_003125.3 Gene:SRP14 / 6727 HGNCID:11299 Length:136 Species:Homo sapiens


Alignment Length:108 Identity:41/108 - (37%)
Similarity:62/108 - (57%) Gaps:1/108 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVLLDNSNFILRLEKIANAAKKDSSFTLTFKRYDGNDKPVPREGRPPLPKPETYMCLMRAQSKSQ 65
            ||||::..|:..|.::....:...|..:|.|:|||..||:|::|.....:|....||:||....:
Human     1 MVLLESEQFLTELTRLFQKCRTSGSVYITLKKYDGRTKPIPKKGTVEGFEPADNKCLLRATDGKK 65

  Fly    66 KISTVVRQEDVPAMMSMYSQFMKSKMDGLKRVKKVKSKAKATK 108
            ||||||..::|......||..:::.|||||:..| |:|.|.||
Human    66 KISTVVSSKEVNKFQMAYSNLLRANMDGLKKRDK-KNKTKKTK 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Srp14NP_650896.2 SRP14 4..94 CDD:280455 29/89 (33%)
SRP14NP_003125.3 SRP14 4..94 CDD:308098 29/89 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..136
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9968
eggNOG 1 0.900 - - E1_KOG1761
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5240
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55799
OrthoDB 1 1.010 - - D1634105at2759
OrthoFinder 1 1.000 - - FOG0005825
OrthoInspector 1 1.000 - - oto89155
orthoMCL 1 0.900 - - OOG6_103910
Panther 1 1.100 - - LDO PTHR12013
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2817
SonicParanoid 1 1.000 - - X5562
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.870

Return to query results.
Submit another query.