DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srp14 and srp14

DIOPT Version :9

Sequence 1:NP_650896.2 Gene:Srp14 / 42436 FlyBaseID:FBgn0038808 Length:109 Species:Drosophila melanogaster
Sequence 2:NP_001028913.1 Gene:srp14 / 619260 ZFINID:ZDB-GENE-050913-131 Length:110 Species:Danio rerio


Alignment Length:108 Identity:46/108 - (42%)
Similarity:64/108 - (59%) Gaps:1/108 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVLLDNSNFILRLEKIANAAKKDSSFTLTFKRYDGNDKPVPREGRPPLPKPETYMCLMRAQSKSQ 65
            ||||:|..|:..|.::....:...|..:|.|:|||..|||||:|.|...:|....||:||....:
Zfish     1 MVLLENDAFLTELTRLFQKCRSSGSVLITLKKYDGRTKPVPRKGHPETFEPADNKCLLRASDGKR 65

  Fly    66 KISTVVRQEDVPAMMSMYSQFMKSKMDGLKRVKKVKSKAKATK 108
            ||||||..::|......||..:::.|||||: |..|||:|.||
Zfish    66 KISTVVSTKEVIKFQMAYSNLLRAHMDGLKK-KDKKSKSKKTK 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Srp14NP_650896.2 SRP14 4..94 CDD:280455 33/89 (37%)
srp14NP_001028913.1 SRP14 4..94 CDD:280455 33/89 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I9161
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I5114
OMA 1 1.010 - - QHG55799
OrthoDB 1 1.010 - - D1634105at2759
OrthoFinder 1 1.000 - - FOG0005825
OrthoInspector 1 1.000 - - oto39134
orthoMCL 1 0.900 - - OOG6_103910
Panther 1 1.100 - - LDO PTHR12013
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2817
SonicParanoid 1 1.000 - - X5562
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1212.010

Return to query results.
Submit another query.