DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srp14 and srp14

DIOPT Version :9

Sequence 1:NP_650896.2 Gene:Srp14 / 42436 FlyBaseID:FBgn0038808 Length:109 Species:Drosophila melanogaster
Sequence 2:NP_001006889.1 Gene:srp14 / 448729 XenbaseID:XB-GENE-489794 Length:110 Species:Xenopus tropicalis


Alignment Length:105 Identity:42/105 - (40%)
Similarity:61/105 - (58%) Gaps:1/105 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVLLDNSNFILRLEKIANAAKKDSSFTLTFKRYDGNDKPVPREGRPPLPKPETYMCLMRAQSKSQ 65
            ||||::..|:..|.::....:...|..:|.|:|||..|||||:|:....:|....||:||....:
 Frog     1 MVLLESEQFLTELTRLFQKCRTSGSVYITLKKYDGRTKPVPRKGQSDSVEPAENKCLLRATDGKK 65

  Fly    66 KISTVVRQEDVPAMMSMYSQFMKSKMDGLKRVKKVKSKAK 105
            ||||||..::|......||..:::.|||||: |..|||.|
 Frog    66 KISTVVSSKEVNKFQMAYSNLLRANMDGLKK-KDKKSKNK 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Srp14NP_650896.2 SRP14 4..94 CDD:280455 31/89 (35%)
srp14NP_001006889.1 SRP14 4..94 CDD:367020 31/89 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 68 1.000 Domainoid score I9594
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5108
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1634105at2759
OrthoFinder 1 1.000 - - FOG0005825
OrthoInspector 1 1.000 - - oto103006
Panther 1 1.100 - - LDO PTHR12013
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2817
SonicParanoid 1 1.000 - - X5562
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.190

Return to query results.
Submit another query.