DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srp14 and RGD1561755

DIOPT Version :9

Sequence 1:NP_650896.2 Gene:Srp14 / 42436 FlyBaseID:FBgn0038808 Length:109 Species:Drosophila melanogaster
Sequence 2:XP_008765554.1 Gene:RGD1561755 / 367306 RGDID:1561755 Length:132 Species:Rattus norvegicus


Alignment Length:108 Identity:35/108 - (32%)
Similarity:58/108 - (53%) Gaps:1/108 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVLLDNSNFILRLEKIANAAKKDSSFTLTFKRYDGNDKPVPREGRPPLPKPETYMCLMRAQSKSQ 65
            ||||.:..|:.:|.::........|..:|.|:.||..||:|::......:|....||:||....:
  Rat     1 MVLLKSEQFLTKLTRLFQKCWSSGSVFITLKKCDGCTKPIPQKSSVEGLEPAENKCLLRATDGKR 65

  Fly    66 KISTVVRQEDVPAMMSMYSQFMKSKMDGLKRVKKVKSKAKATK 108
            |||||...::.......||..:::.|:|||:..| |:|:|.:|
  Rat    66 KISTVGSSKEENKFEMAYSNLLRADMNGLKKRDK-KNKSKKSK 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Srp14NP_650896.2 SRP14 4..94 CDD:280455 24/89 (27%)
RGD1561755XP_008765554.1 SRP14 4..94 CDD:280455 24/89 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D636041at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.