DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srp14 and srp14

DIOPT Version :9

Sequence 1:NP_650896.2 Gene:Srp14 / 42436 FlyBaseID:FBgn0038808 Length:109 Species:Drosophila melanogaster
Sequence 2:NP_594772.1 Gene:srp14 / 2542565 PomBaseID:SPAC19B12.09 Length:106 Species:Schizosaccharomyces pombe


Alignment Length:112 Identity:34/112 - (30%)
Similarity:53/112 - (47%) Gaps:17/112 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VLLDNSNFILRLEKI--ANAAKKDSSFTLTFKRYDGNDKPVPREGRPPLPKPETYMCLMRAQS-K 63
            :||.|..|:.:|..:  .:.:|...|..|:.|     ..||. ||     :..:...|:||:| .
pombe     1 MLLSNEEFLKKLTDLLQTHQSKGTGSVYLSQK-----CNPVD-EG-----EGSSASVLIRAKSGA 54

  Fly    64 SQKISTVVRQEDVPAMMSMYSQFMKSKMDGLK---RVKKVKSKAKAT 107
            ::||||||..:........|::..|.::.|||   |.|..|:|.|.|
pombe    55 AEKISTVVELDYFTDFFQSYAEVCKGQIVGLKKRDRKKTKKNKKKTT 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Srp14NP_650896.2 SRP14 4..94 CDD:280455 24/92 (26%)
srp14NP_594772.1 SRP14 3..85 CDD:280455 24/92 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1761
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005825
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103910
Panther 1 1.100 - - LDO PTHR12013
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.860

Return to query results.
Submit another query.