DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srp14 and Srp14

DIOPT Version :9

Sequence 1:NP_650896.2 Gene:Srp14 / 42436 FlyBaseID:FBgn0038808 Length:109 Species:Drosophila melanogaster
Sequence 2:NP_033299.1 Gene:Srp14 / 20813 MGIID:107169 Length:110 Species:Mus musculus


Alignment Length:108 Identity:40/108 - (37%)
Similarity:62/108 - (57%) Gaps:1/108 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVLLDNSNFILRLEKIANAAKKDSSFTLTFKRYDGNDKPVPREGRPPLPKPETYMCLMRAQSKSQ 65
            ||||::..|:..|.::....:...|..:|.|:|||..||:||:......:|....||:||....:
Mouse     1 MVLLESEQFLTELTRLFQKCRSSGSVFITLKKYDGRTKPIPRKSSVEGLEPAENKCLLRATDGKR 65

  Fly    66 KISTVVRQEDVPAMMSMYSQFMKSKMDGLKRVKKVKSKAKATK 108
            ||||||..::|......||..:::.|||||:..| |:|:|.:|
Mouse    66 KISTVVSSKEVNKFQMAYSNLLRANMDGLKKRDK-KNKSKKSK 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Srp14NP_650896.2 SRP14 4..94 CDD:280455 29/89 (33%)
Srp14NP_033299.1 SRP14 4..94 CDD:367020 29/89 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..110 10/19 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9975
eggNOG 1 0.900 - - E1_KOG1761
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I5228
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55799
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005825
OrthoInspector 1 1.000 - - oto92720
orthoMCL 1 0.900 - - OOG6_103910
Panther 1 1.100 - - LDO PTHR12013
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2817
SonicParanoid 1 1.000 - - X5562
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.