DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srp14 and F25G6.8

DIOPT Version :9

Sequence 1:NP_650896.2 Gene:Srp14 / 42436 FlyBaseID:FBgn0038808 Length:109 Species:Drosophila melanogaster
Sequence 2:NP_505208.1 Gene:F25G6.8 / 179236 WormBaseID:WBGene00017799 Length:116 Species:Caenorhabditis elegans


Alignment Length:119 Identity:36/119 - (30%)
Similarity:57/119 - (47%) Gaps:25/119 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LDNSNFILRLEKIANAAKKDS------SFTLTFKRYDGNDKPVP-----REGRPPLPKPETYMCL 57
            :.|..|:.:|    .|..:||      |..:|.|.|||..|.:|     :||       :...|:
 Worm     8 IPNDQFLQKL----TAFYRDSKIRGPKSVYVTMKPYDGRTKAMPKGSTFKEG-------DEISCI 61

  Fly    58 MRAQSKSQKISTVVRQEDVPAMMSMYSQFMKSKMDGLKRVKKV---KSKAKATK 108
            .||:..|:||:|.|:.::|....:.||..:.::|..|::.||.   |.|..|||
 Worm    62 FRAKWGSKKIATEVKAKEVNKFHTQYSAIIVAQMVNLEKRKKTDDEKKKTGATK 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Srp14NP_650896.2 SRP14 4..94 CDD:280455 28/100 (28%)
F25G6.8NP_505208.1 SRP14 10..98 CDD:280455 28/98 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1761
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55799
OrthoDB 1 1.010 - - D1634105at2759
OrthoFinder 1 1.000 - - FOG0005825
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103910
Panther 1 1.100 - - LDO PTHR12013
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2817
SonicParanoid 1 1.000 - - X5562
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.860

Return to query results.
Submit another query.