DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EloB and Elob

DIOPT Version :9

Sequence 1:NP_524416.1 Gene:EloB / 42435 FlyBaseID:FBgn0023212 Length:118 Species:Drosophila melanogaster
Sequence 2:NP_112391.1 Gene:Elob / 81807 RGDID:621200 Length:118 Species:Rattus norvegicus


Alignment Length:118 Identity:65/118 - (55%)
Similarity:87/118 - (73%) Gaps:2/118 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDVFLMIRRQKTTIFTDAKENTTVAELKRMIEGILKVQPVDQRLYNQDNDVMEDDSTLQDYGVTV 65
            |||||||||.||||||||||::||.||||::|||||..|.:|||| :|:.:::|..||.:.|.|.
  Rat     1 MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPEEQRLY-KDDQLLDDGKTLGECGFTS 64

  Fly    66 STAKAQAPAQLGLTFRNEVGDFETLDMTPYSAPPDLPEVMKNQEASNGQEQVA 118
            .||:.||||.:||.||.: ..||.|.:.|:|:||:||:|||.|::.....:.|
  Rat    65 QTARPQAPATVGLAFRAD-DTFEALRIEPFSSPPELPDVMKPQDSGGSANEQA 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EloBNP_524416.1 Ubl_ElonginB 2..104 CDD:340486 59/101 (58%)
ElobNP_112391.1 Ubl_ElonginB 2..102 CDD:340486 59/101 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..118 11/26 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342335
Domainoid 1 1.000 64 1.000 Domainoid score I9864
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H136219
Inparanoid 1 1.050 125 1.000 Inparanoid score I4607
OMA 1 1.010 - - QHG48541
OrthoDB 1 1.010 - - D1637528at2759
OrthoFinder 1 1.000 - - FOG0001929
OrthoInspector 1 1.000 - - otm63538
orthoMCL 1 0.900 - - OOG6_104670
Panther 1 1.100 - - LDO PTHR13248
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2199
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.