DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EloB and elob

DIOPT Version :9

Sequence 1:NP_524416.1 Gene:EloB / 42435 FlyBaseID:FBgn0023212 Length:118 Species:Drosophila melanogaster
Sequence 2:NP_988962.1 Gene:elob / 394559 XenbaseID:XB-GENE-959169 Length:119 Species:Xenopus tropicalis


Alignment Length:118 Identity:69/118 - (58%)
Similarity:87/118 - (73%) Gaps:1/118 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDVFLMIRRQKTTIFTDAKENTTVAELKRMIEGILKVQPVDQRLYNQDNDVMEDDSTLQDYGVTV 65
            ||||||||..||||||||||:|||.||||::|||||..|.||:|| :|:.|::|:.||.|.|.|.
 Frog     1 MDVFLMIRHHKTTIFTDAKESTTVYELKRIVEGILKRPPEDQKLY-KDDQVLDDNKTLGDCGFTS 64

  Fly    66 STAKAQAPAQLGLTFRNEVGDFETLDMTPYSAPPDLPEVMKNQEASNGQEQVA 118
            .||:.||||.:||.||:....||.|.:.|:|:||:||:|||.||.|....:.|
 Frog    65 QTARPQAPATVGLAFRSSGDSFEPLRVDPFSSPPELPDVMKPQETSGSANEQA 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EloBNP_524416.1 Ubl_ElonginB 2..104 CDD:340486 61/101 (60%)
elobNP_988962.1 Ubl_ElonginB 2..103 CDD:340486 61/101 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I9535
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H136219
Inparanoid 1 1.050 130 1.000 Inparanoid score I4516
OMA 1 1.010 - - QHG48541
OrthoDB 1 1.010 - - D1637528at2759
OrthoFinder 1 1.000 - - FOG0001929
OrthoInspector 1 1.000 - - oto104468
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2199
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.980

Return to query results.
Submit another query.