DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EloB and RGD1565653

DIOPT Version :9

Sequence 1:NP_524416.1 Gene:EloB / 42435 FlyBaseID:FBgn0023212 Length:118 Species:Drosophila melanogaster
Sequence 2:XP_017451626.1 Gene:RGD1565653 / 367176 RGDID:1565653 Length:141 Species:Rattus norvegicus


Alignment Length:115 Identity:61/115 - (53%)
Similarity:81/115 - (70%) Gaps:3/115 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VFLMIRRQKTTIFTDAKENTTVAELKRMIEGILKVQPVDQRLYNQDNDVMEDDSTLQDYGVTVST 67
            |||||||.|||||||.||:.||.|||.:::||||..|.:|||| :|..:::...||.:.|.|..|
  Rat    26 VFLMIRRHKTTIFTDPKESNTVFELKHIVKGILKRPPEEQRLY-KDGQLLDGGKTLGECGFTSQT 89

  Fly    68 AKAQAPAQLGLTFRNEVGDFETLDMTPYSAPPDLPEVMKNQEA-SNGQEQ 116
            |:.||||.:||.||.: ..||.|.|.|:|:|.:||:|||.|:: .:|.||
  Rat    90 ARPQAPATVGLAFRAD-DTFEALRMEPFSSPLELPDVMKPQDSGGSGNEQ 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EloBNP_524416.1 Ubl_ElonginB 2..104 CDD:340486 54/100 (54%)
RGD1565653XP_017451626.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1637528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.